KEGG   Zygosaccharomyces rouxii: ZYRO0G08844gHelp
Entry
ZYRO0G08844g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:zro00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    ZYRO0G08844g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     ZYRO0G08844g
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   ZYRO0G08844g
Messenger RNA biogenesis [BR:zro03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     ZYRO0G08844g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(711678..712766)
Genome map
AA seq 362 aa AA seqDB search
MEYYEQYPHHHHHHHHFRQPEQAVPASASSHHKSLLPQRSGISKGKYSLKDFQIMRTLGT
GSFGRVHLVRSVHNGRYYAMKVLKKQQVVKMKQIEHTNDERHMLKLVEHPFIIRMWGTFQ
DAKNLFMVIDYIEGGELFSLLRKSHRFPNPVAKFYAAEVTLALDYLHSHNIIYRDLKPEN
LLLDRNGHIKITDFGFAKEVVTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIFEM
LAGYTPFYDATAMKTYEKILQGKVNYPPFFHPDVVDLLSKLIMADLTRRLGNLQSGSQDI
KSHPWFGEVIWEKLLAKDIETPYEPPVVPGVGDTSLFEMYPEEHLDYGATGDDPYGQYFV
GF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaatattacgaacaatatccacatcatcaccatcaccatcaccatttccgacagccg
gagcaagctgtgccggcttctgcatcttctcatcataaatctttgcttccccagagatca
ggaatctctaaagggaagtattcgctaaaagatttccaaatcatgagaactttaggtaca
ggatcctttggacgtgttcatttggtaagatcagttcacaatggtaggtactatgcaatg
aaagtcttgaaaaaacagcaagttgttaagatgaaacaaattgaacatacgaacgatgaa
agacatatgctaaaattagtcgagcatcccttcatcattcgtatgtgggggacgttccag
gatgctaaaaaccttttcatggtaatagactacatcgaaggtggtgaattattttcacta
cttcgtaaatctcataggttccccaatcctgttgctaaattttatgcagccgaggtaact
ttggctttagattacttgcattctcacaatattatttatcgtgatttgaagcctgaaaat
ctcttgttggatagaaatggtcacataaaaattacagattttggatttgccaaggaagtt
gttacggtaacatggaccctgtgtggtacacctgattatattgcacctgaagttattacg
acaaaaccatataataaatctgttgattggtggtcattaggggttctaatctttgaaatg
ttggcaggatatacacctttttatgatgcaacggctatgaagacttacgaaaaaattcta
caaggtaaggttaattatccaccattcttccatcctgatgttgttgatcttttgagtaaa
ttgatcatggcggatttaactagaagattgggtaatttacaaagtggatcacaggatatt
aaatcacatccatggtttggtgaagttatttgggaaaaattattggcaaaggatatcgag
actccatatgagcctcctgttgtacccggcgttggtgatacttctttgtttgagatgtac
cccgaagaacatttagactacggagctaccggtgacgacccatacggtcaatatttcgtc
ggattttag

DBGET integrated database retrieval system