KEGG   Zygosaccharomyces rouxii: ZYRO0G09306gHelp
Entry
ZYRO0G09306g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ZYRO0G09306g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ZYRO0G09306g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(742041..742679)
Genome map
AA seq 212 aa AA seqDB search
MRALIVVDVQNDFLPGGSLAVPHGDEIVKPVIDLIEDPTEKWDQVVMTRDWHPHNHISFA
KSHNLADFSPITYVSPVEGDDRKIEGTLFPVHCVEGTRGSQLAPEMLEEQKKIGCLIVSK
GYLQDREYFSAFNDIWDHHKTELNNYLHCHGIDEVYVVGLAFEYCVKSTAISASKLGYKT
TILQKYSKGFLSDEKSMQELKQELAENNVQLA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagagctctaatagtagttgatgtgcaaaatgatttcttgccaggaggttcactcgct
gttcctcatggtgatgagatagttaagccggtaattgacctcattgaagatccaactgaa
aaatgggaccaagtggtaatgacaagggactggcacccacataatcacatttcatttgcc
aaatcacataacttggcagatttctcaccgattacctatgtttccccggtggaaggtgat
gatcgaaagatagaaggaacgttatttcctgtgcactgtgtagaaggaactcgtgggagc
caattggcaccagaaatgcttgaagaacaaaaaaaaattggctgcctcatagttagtaag
ggttaccttcaagacagggagtacttctctgcatttaacgatatctgggatcatcacaag
actgagctgaataattatttacattgccatggaattgacgaggtctacgtagttggactt
gcctttgaatattgcgttaagagtacggctatcagtgcatcgaaattgggttataagaca
acaattctgcagaagtattcaaaaggcttcctctctgacgaaaaatctatgcaggaattg
aaacaggaactggctgagaacaacgttcaactagcatag

DBGET integrated database retrieval system