KEGG   Zygosaccharomyces rouxii: ZYRO0G09482gHelp
Entry
ZYRO0G09482g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ZYRO0G09482g
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    ZYRO0G09482g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     ZYRO0G09482g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:756123..757040
Genome map
AA seq 305 aa AA seqDB search
MSFLADSIYGKDNVKFLKVKKDASNPKLQQIMEATVKVLLKGNFDVSYTEADNSPIVPTD
TVKNTILILAKTNDTWPSEKFASTLALHFTTKYAHVSGVSIQIYQERWVKFNVDGAPSQH
SFVHQGPEKKIVELDYDKVPGPAQYKLSTSIKDLTVLKSTNSMFYGYNVCDYTTLKPTED
RVLSTDIYSKWDWSPSRLGSLHTLSSGSCDGIFDQVYDEARAITLDIFAKENSASVQATM
YNMATEILKKAPQVEYVSYELPNKHYFLFDFKWFKGLENDNELFYPSPHPNGLIKCKVGR
KASKL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttttagctgattccatctatggtaaagacaatgtcaagttcctcaaggttaag
aaggatgcatcaaatccaaaattacaacaaatcatggaagctactgttaaagtgctattg
aaaggtaattttgatgtttcctacaccgaagctgataattcaccaattgtcccaactgat
accgttaagaacaccattttgattttggcaaagactaacgatacttggccatccgaaaaa
tttgcctctacattagcactccatttcactaccaaatatgctcatgtctcaggtgtctct
attcagatctaccaagaacgttgggttaaatttaacgttgatggagccccaagtcaacac
tcatttgttcaccagggtcctgaaaagaaaattgtagaactagactacgataaggttcca
ggacctgcccaatacaaattgagcactagtatcaaagatttgaccgttttgaaatctacc
aattctatgttttatgggtacaacgtttgtgattacaccactttgaaacctacagaggat
cgtgttttgtcgactgacatttacagtaaatgggactggtctccatctagattaggatcc
cttcacactttatctagcggatcttgtgatggtatttttgatcaagtctatgatgaagca
agagccataactttggacatctttgccaaagaaaattctgcttcagtgcaagcaaccatg
tacaatatggctactgaaattttgaaaaaggcaccacaagtggagtacgtttcctatgaa
ttacctaacaaacactatttcctatttgacttcaaatggtttaaaggtctagaaaatgac
aatgaattattctacccatcaccacatccaaatgggttgattaagtgtaaggttggtcgt
aaggcttctaaattgtaa

DBGET integrated database retrieval system