KEGG   Zygosaccharomyces rouxii: ZYRO0G09746gHelp
Entry
ZYRO0G09746g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZYRO0G09746g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZYRO0G09746g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZYRO0G09746g
Enzymes [BR:zro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZYRO0G09746g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(775201..777327)
Genome map
AA seq 708 aa AA seqDB search
MSELLRQTFANAKKEGRNALITFMTAGYPRVEDTIPILKGFQEGGVDVIELGMPFSDPIA
DGPTIQVSNTVALQNNVTLKQTLELVAKARAEGITVPILLMGYYNPILTYGEERFIKDAA
EVGVNGFIIVDLPPEEALKVRNYVRDNGLSLIPLVAPSTTNERLELLSKVADSFVYVVSR
MGTTGAQSSMANDLDELVNRVKQYTKEIPIAVGFGVSHRQHFLDVGQHSDGVVIGSKIIT
LVGEAPEGKRGEVAKNYVSEILNGVTHSTLSKEEFKEIQKKSIEIAKQQQELVNTFQEVH
KFPIRFGDFGGQYVPEALHACLRELEQGFDEAVVDPKFWEDFRSLYSYIGRPSSLHKAAR
LSEYIGGAQIWLKREDLNHTGSHKINNALAQVLLAKRLKKTEVIAETGAGQHGVATATAC
AKFGLGCTVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTKTLRDATSEAFRFWVSNLKT
TYYVVGSAIGPHPYPTLVRTFQSVIGQETKEQFAALNDGKLPDAVVACVGGGSNSSGMFS
PFEKDLSVKLLGVEAGGDGIDTDYHSATLTAGRPGVFHGVRTFVLQDKEGQVHDTHSVSA
GLDYPGVGPELAFWKASGRADFVAATDAQALQGFKLLSQLEGVIPALETSHAVYGACELA
KTLKPDQHIIINVSGRGDKDVQSVAEVLPKLGPKIGWNLRFEEDPSSG
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattactaagacagacttttgccaatgcaaaaaaagagggtcgtaatgctctt
attaccttcatgaccgctggttaccctagagttgaagatactattccaattctaaaaggc
ttccaagaaggtggtgttgatgtgatcgaattaggtatgccattctcggatccaatcgca
gatggtcctacgattcaagtgtctaacactgtagcccttcaaaataacgtcactttgaag
caaactttggaactggtcgcaaaagctagagcagaaggtattaccgtgcccattctcctc
atgggttattacaacccaattttgacctacggtgaagaacgattcattaaagatgcagct
gaagttggtgtcaacgggtttatcattgtggatctaccacctgaagaagctctcaaggta
agaaactacgttagagataatggattgagtttgattccactagtggcaccatcaaccaca
aatgaaagattagaacttttgtctaaagttgcagattcttttgtctacgtggtctctaga
atgggtactactggtgctcaatcttcgatggcaaatgatttggatgagttggtgaatcgt
gtgaagcagtataccaaagaaattccaattgcagttggattcggtgtttcccacaggcaa
catttcttggacgttggtcaacactctgatggtgtcgtcatcgggtctaagatcatcacc
ctggttggtgaagctcctgagggtaaacgtggagaagtcgcaaagaattacgttagtgaa
atcttgaacggtgtcacacatagtactttgtctaaggaggagttcaaagaaattcagaaa
aaatccattgagatcgcaaaacagcaacaggaattagttaacaccttccaagaagtccac
aagttcccaattagatttggtgatttcggtggtcaatacgtaccagaagcgttacatgca
tgtttaagagaattggaacaaggttttgatgaggcagttgttgatccaaaattctgggaa
gatttcagatctttgtactcctacatcggccgtccatcatctttgcataaggcagctaga
ctttctgaatacattggcggtgctcaaatctggttgaaaagagaagatttgaaccacacc
ggttctcacaagattaacaacgctttagctcaagttttattggctaagagattgaaaaag
actgaagtcattgcagaaaccggtgcaggtcaacatggtgtggccacagctactgcatgt
gctaaattcggtcttggttgtaccgtctttatgggtgctgaagatgttcgtcgccaggct
cttaacgttttcagaatgagaatccttggtgctaaagtggttgctgtgactaacggtact
aagactctaagagatgctacctcagaggcattccgtttctgggtcagtaatttaaagaca
acttactatgtggttggttctgctattggccctcatccatacccaactttggtgcgtacc
ttccaaagtgttatcggacaagaaactaaagaacaatttgccgctcttaacgacggtaaa
ttgcctgatgctgtcgttgcatgtgtcggtggtggttctaactccagtggtatgttttca
ccttttgaaaaagatttaagcgtcaaacttctcggtgtggaagcaggtggtgatggtatt
gatactgattaccattctgctactttgactgctggtagaccaggtgttttccacggtgtg
aggaccttcgtccttcaagataaagagggtcaagtccatgatactcactctgtgtctgca
ggtttagattatcctggtgttggtcccgaattagcattctggaaggcatctggtcgtgct
gattttgtagcagccactgatgctcaagctttgcaaggtttcaaattattgtcacaatta
gaaggtgtgattccagcattagaaacttctcatgcagtctacggtgcttgtgagttggca
aagaccttgaaaccagatcaacatatcattatcaatgtgtctggtagaggtgacaaggac
gttcaatccgtagcagaagttctacctaaattgggtcctaagattggatggaacttgaga
ttcgaagaggacccatcatctggttaa

DBGET integrated database retrieval system