KEGG   Zygosaccharomyces rouxii: ZYRO0G09746gHelp
Entry
ZYRO0G09746g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZYRO0G09746g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZYRO0G09746g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZYRO0G09746g
Enzymes [BR:zro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZYRO0G09746g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(775201..777327)
Genome map
AA seq 708 aa AA seqDB search
MSELLRQTFANAKKEGRNALITFMTAGYPRVEDTIPILKGFQEGGVDVIELGMPFSDPIA
DGPTIQVSNTVALQNNVTLKQTLELVAKARAEGITVPILLMGYYNPILTYGEERFIKDAA
EVGVNGFIIVDLPPEEALKVRNYVRDNGLSLIPLVAPSTTNERLELLSKVADSFVYVVSR
MGTTGAQSSMANDLDELVNRVKQYTKEIPIAVGFGVSHRQHFLDVGQHSDGVVIGSKIIT
LVGEAPEGKRGEVAKNYVSEILNGVTHSTLSKEEFKEIQKKSIEIAKQQQELVNTFQEVH
KFPIRFGDFGGQYVPEALHACLRELEQGFDEAVVDPKFWEDFRSLYSYIGRPSSLHKAAR
LSEYIGGAQIWLKREDLNHTGSHKINNALAQVLLAKRLKKTEVIAETGAGQHGVATATAC
AKFGLGCTVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTKTLRDATSEAFRFWVSNLKT
TYYVVGSAIGPHPYPTLVRTFQSVIGQETKEQFAALNDGKLPDAVVACVGGGSNSSGMFS
PFEKDLSVKLLGVEAGGDGIDTDYHSATLTAGRPGVFHGVRTFVLQDKEGQVHDTHSVSA
GLDYPGVGPELAFWKASGRADFVAATDAQALQGFKLLSQLEGVIPALETSHAVYGACELA
KTLKPDQHIIINVSGRGDKDVQSVAEVLPKLGPKIGWNLRFEEDPSSG
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattactaagacagacttttgccaatgcaaaaaaagagggtcgtaatgctctt
attaccttcatgaccgctggttaccctagagttgaagatactattccaattctaaaaggc
ttccaagaaggtggtgttgatgtgatcgaattaggtatgccattctcggatccaatcgca
gatggtcctacgattcaagtgtctaacactgtagcccttcaaaataacgtcactttgaag
caaactttggaactggtcgcaaaagctagagcagaaggtattaccgtgcccattctcctc
atgggttattacaacccaattttgacctacggtgaagaacgattcattaaagatgcagct
gaagttggtgtcaacgggtttatcattgtggatctaccacctgaagaagctctcaaggta
agaaactacgttagagataatggattgagtttgattccactagtggcaccatcaaccaca
aatgaaagattagaacttttgtctaaagttgcagattcttttgtctacgtggtctctaga
atgggtactactggtgctcaatcttcgatggcaaatgatttggatgagttggtgaatcgt
gtgaagcagtataccaaagaaattccaattgcagttggattcggtgtttcccacaggcaa
catttcttggacgttggtcaacactctgatggtgtcgtcatcgggtctaagatcatcacc
ctggttggtgaagctcctgagggtaaacgtggagaagtcgcaaagaattacgttagtgaa
atcttgaacggtgtcacacatagtactttgtctaaggaggagttcaaagaaattcagaaa
aaatccattgagatcgcaaaacagcaacaggaattagttaacaccttccaagaagtccac
aagttcccaattagatttggtgatttcggtggtcaatacgtaccagaagcgttacatgca
tgtttaagagaattggaacaaggttttgatgaggcagttgttgatccaaaattctgggaa
gatttcagatctttgtactcctacatcggccgtccatcatctttgcataaggcagctaga
ctttctgaatacattggcggtgctcaaatctggttgaaaagagaagatttgaaccacacc
ggttctcacaagattaacaacgctttagctcaagttttattggctaagagattgaaaaag
actgaagtcattgcagaaaccggtgcaggtcaacatggtgtggccacagctactgcatgt
gctaaattcggtcttggttgtaccgtctttatgggtgctgaagatgttcgtcgccaggct
cttaacgttttcagaatgagaatccttggtgctaaagtggttgctgtgactaacggtact
aagactctaagagatgctacctcagaggcattccgtttctgggtcagtaatttaaagaca
acttactatgtggttggttctgctattggccctcatccatacccaactttggtgcgtacc
ttccaaagtgttatcggacaagaaactaaagaacaatttgccgctcttaacgacggtaaa
ttgcctgatgctgtcgttgcatgtgtcggtggtggttctaactccagtggtatgttttca
ccttttgaaaaagatttaagcgtcaaacttctcggtgtggaagcaggtggtgatggtatt
gatactgattaccattctgctactttgactgctggtagaccaggtgttttccacggtgtg
aggaccttcgtccttcaagataaagagggtcaagtccatgatactcactctgtgtctgca
ggtttagattatcctggtgttggtcccgaattagcattctggaaggcatctggtcgtgct
gattttgtagcagccactgatgctcaagctttgcaaggtttcaaattattgtcacaatta
gaaggtgtgattccagcattagaaacttctcatgcagtctacggtgcttgtgagttggca
aagaccttgaaaccagatcaacatatcattatcaatgtgtctggtagaggtgacaaggac
gttcaatccgtagcagaagttctacctaaattgggtcctaagattggatggaacttgaga
ttcgaagaggacccatcatctggttaa

DBGET integrated database retrieval system