KEGG   Zygosaccharomyces rouxii: ZYRO0G12408gHelp
Entry
ZYRO0G12408g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00010  Glycolysis / Gluconeogenesis
zro00051  Fructose and mannose metabolism
zro00562  Inositol phosphate metabolism
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
zro01130  Biosynthesis of antibiotics
zro01200  Carbon metabolism
zro01230  Biosynthesis of amino acids
Module
zro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zro_M00002  Glycolysis, core module involving three-carbon compounds
zro_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0G12408g
   00051 Fructose and mannose metabolism
    ZYRO0G12408g
   00562 Inositol phosphate metabolism
    ZYRO0G12408g
Enzymes [BR:zro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ZYRO0G12408g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZYRO0G12408g
  Exosomal proteins of bladder cancer cells
   ZYRO0G12408g
  Exosomal proteins of melanoma cells
   ZYRO0G12408g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Head-tail_con
Motif
Other DBs
NCBI-GeneID: 8206340
NCBI-ProteinID: XP_002498527
UniProt: C5E0G0
Position
G:980988..981734
Genome map
AA seq 248 aa AA seqDB search
MARNFFIGGNFKLNGSKASIKEIVDRLNDSKLDPNAEVVICPPAPYLGYTVDLTKSPQVS
VGAQNAYLKASGAFTGENSVDQIKDVGAKWVIIGHSERRQYFHEDDKLIAEKTAFAVGQG
VGVILCIGETLEEKKAGTTLQVVERQLQAALETCNDWSKIVVAYEPVWAIGTGLAATAED
AQDIHHSIREFLAKKLGEKVASEIRILYGGSANGKNASSFKDKADVDGFLVGGASLKPEF
VDIINSRL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaacttcttcattggtggtaacttcaaattgaacggtagcaaggcttccatt
aaggaaatcgtcgacagattgaacgactccaagttggacccaaacgctgaggtcgttatc
tgccctccagctccttacttgggctacaccgtcgacctaaccaagtccccacaagtctcc
gtcggtgctcaaaacgcttacctaaaggccagcggtgccttcactggtgaaaactccgtc
gaccaaatcaaggacgtcggtgccaagtgggttatcattggtcactccgaaagaagacaa
tacttccacgaagacgacaaattgatcgctgaaaagaccgctttcgccgtcggccaaggt
gtcggtgtcatcttgtgtatcggtgaaactttggaagaaaagaaggctggtaccactcta
caagtcgtcgaaagacaattgcaagccgctttggaaacctgcaacgactggtccaagatc
gtcgttgcttacgaaccagtgtgggctatcggtaccggtctagcagctaccgctgaagac
gctcaagacatccaccactccatcagagaattcttggccaagaagttgggtgaaaaggtt
gcctctgaaatcagaatcttgtacggtggttccgctaacggtaagaacgcttcctctttc
aaggacaaggctgacgttgatggattcttggtcggtggtgcttctttgaagccagaattc
gtcgacatcatcaactctagattgtaa

DBGET integrated database retrieval system