KEGG   Zygosaccharomyces rouxii: ZYRO0G12408gHelp
Entry
ZYRO0G12408g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZYRO0G12408g
   01230 Biosynthesis of amino acids
    ZYRO0G12408g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0G12408g
   00051 Fructose and mannose metabolism
    ZYRO0G12408g
   00562 Inositol phosphate metabolism
    ZYRO0G12408g
Enzymes [BR:zro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ZYRO0G12408g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZYRO0G12408g
  Exosomal proteins of bladder cancer cells
   ZYRO0G12408g
  Exosomal proteins of melanoma cells
   ZYRO0G12408g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
G:980988..981734
Genome map
AA seq 248 aa AA seqDB search
MARNFFIGGNFKLNGSKASIKEIVDRLNDSKLDPNAEVVICPPAPYLGYTVDLTKSPQVS
VGAQNAYLKASGAFTGENSVDQIKDVGAKWVIIGHSERRQYFHEDDKLIAEKTAFAVGQG
VGVILCIGETLEEKKAGTTLQVVERQLQAALETCNDWSKIVVAYEPVWAIGTGLAATAED
AQDIHHSIREFLAKKLGEKVASEIRILYGGSANGKNASSFKDKADVDGFLVGGASLKPEF
VDIINSRL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaacttcttcattggtggtaacttcaaattgaacggtagcaaggcttccatt
aaggaaatcgtcgacagattgaacgactccaagttggacccaaacgctgaggtcgttatc
tgccctccagctccttacttgggctacaccgtcgacctaaccaagtccccacaagtctcc
gtcggtgctcaaaacgcttacctaaaggccagcggtgccttcactggtgaaaactccgtc
gaccaaatcaaggacgtcggtgccaagtgggttatcattggtcactccgaaagaagacaa
tacttccacgaagacgacaaattgatcgctgaaaagaccgctttcgccgtcggccaaggt
gtcggtgtcatcttgtgtatcggtgaaactttggaagaaaagaaggctggtaccactcta
caagtcgtcgaaagacaattgcaagccgctttggaaacctgcaacgactggtccaagatc
gtcgttgcttacgaaccagtgtgggctatcggtaccggtctagcagctaccgctgaagac
gctcaagacatccaccactccatcagagaattcttggccaagaagttgggtgaaaaggtt
gcctctgaaatcagaatcttgtacggtggttccgctaacggtaagaacgcttcctctttc
aaggacaaggctgacgttgatggattcttggtcggtggtgcttctttgaagccagaattc
gtcgacatcatcaactctagattgtaa

DBGET integrated database retrieval system