KEGG   Zygosaccharomyces rouxii: ZYRO0G12474gHelp
Entry
ZYRO0G12474g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:zro03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:983564..986269
Genome map
AA seq 901 aa AA seqDB search
MQLPTYVNRPFKPPRRINSAGSDSNVTLKRQVETTPSKDVKRSKPESQPMEGDRKYFTIM
YRKPTTKKHKTWNGDGFAQLKQGNRLAFYNETGKYFGSTSVNGSLESYFYNVSRAGSLEV
QLDYQVSDPKELSKICSLIETGNESSGRPTSQSSLAPSPKGSPPRLTPKVVTQFRTSLKP
SKFQTPTTNANSTKDQRDKKYLPVFDIDKIENPIVMNKSLRADVDVVVDPMLSKLLRPHQ
RDGVKFMYDCVMGLARPDDGIDTASKSLVLENDSDIQGCILADEMGLGKTLMTITLIWTL
LKQTPMASKVSCSQNGVPLQGLCKKIIIVCPVTLIANWKREFGKWLNLSRIGILTLSPQN
NAERDIYDVKSFLRVQRTYQVLIIGYEKLLSVAQELENGKNLIDLLVCDEGHRLKNGSSK
VLNILKNLEIPRKIILSGTPIQNDLNEFFTIIDFINPGVLGSYPFFKKRFMTPITKARDP
ANRFNLHVVEKGQERSEEMISITRRFILRRTNSILSKYLPPKMDIILFCKPTNHQISAFK
DILQGANIDLQRLNFNSSLALITLLKKICNSPTLIQTDSYYKSSMQNSRISQKYQNEYNS
GKLRVLMKLLNQIKIETTSDKVVVISNYTQTLDIIENLMASAGMSSCRLDGSTPAKQRDA
IVNNFNHNPSIFAFLLSAKSGGVGLNLIGACRLILFDNDWNPSVDLQAMSRIHRDGQKKP
CYIYRLVTTGCIDEKILQRQLMKNCLSQKFLSDTKSTKGSADDDLFNKEDLKDLFTVLVD
TPSNTHDLICSCEGIGEEVTLQDHQDSQNNKNYESSREHKLSKWNSAFEAQKVMEEIEAS
ASKSKECNIKKCLIGYKHIDPNKTHDLLDDVATEALKSLQNDITFAFVHPGESHLEGTSH
K
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttccaacgtacgttaatagaccttttaaacccccaagaaggattaattctgct
ggttcagattctaatgtcacattgaagaggcaggttgagactaccccgagcaaagatgtt
aagagatctaagccggaatcgcaacctatggagggagatcgcaagtacttcacgataatg
tatcgtaagccaacgacaaagaaacacaagacctggaatggcgatgggtttgctcaattg
aaacagggcaatagacttgcattttacaacgaaactggaaaatatttcggtagcaccagc
gtaaatggatcgctggaatcgtacttttataacgtttcgagagctggatctcttgaagtt
caattggattaccaagtttcggatcccaaggaattgagtaaaatatgcagcttgattgaa
accggtaacgaatcaagcggtagacccacatcccaatcttcactagcgccttcaccaaag
ggttcaccgccaagattgacccccaaagtcgtaacgcaatttaggacatcgcttaaacca
tccaaatttcaaaccccaactacgaatgccaactcgactaaagatcaaagggacaagaag
tacttacctgtatttgacatcgataagattgaaaaccccattgtgatgaacaaaagctta
cgtgccgacgtggatgtggtggtagatccgatgctaagcaagctcttgagacctcatcaa
cgggatggggttaagtttatgtacgattgtgtcatgggtttagcaagacctgacgatggt
attgacactgcttcgaaaagtcttgttttggagaatgattctgacattcaaggatgtatt
ttagccgatgaaatggggttaggtaagactttgatgacaataaccctgatttggacatta
ctcaagcaaactcctatggcctccaaagtttcctgttctcaaaatggcgtccctttacaa
ggcctctgtaaaaaaattattatcgtttgtcccgttacattgattgccaattggaaaagg
gagtttggtaaatggcttaacctttctagaattggtatattgacgctaagtcctcaaaac
aacgctgagagggacatttatgatgttaaaagtttcctaagagtacaaagaacttatcaa
gtcctaattattggttatgagaaattgttatcagtagcacaggaactagaaaatggaaag
aatcttattgatttattggtatgcgatgaaggtcatcgattgaagaatgggtcctctaaa
gttcttaacattctgaaaaatcttgagattccaaggaaaataatcctatcaggaacacca
attcaaaatgatcttaacgaattttttacaattatcgattttataaatcctggtgtattg
ggtagttacccatttttcaagaaaagatttatgacccccattacgaaggccagagatccc
gccaatagatttaatctccatgtcgtggaaaagggacaagaaagatcggaagaaatgatt
tctatcactaggaggttcattctcagaagaacgaattcaattctcagcaaatacttacca
cccaaaatggatatcattcttttttgcaaaccaacgaaccatcagatttccgcgtttaaa
gatattttacagggggcaaatatcgatttgcaacgtctgaacttcaattcctcccttgca
ttaattacacttttgaaaaaaatttgcaattcacccactctcatacaaacggattcctac
tataaatccagtatgcaaaatagtaggatttctcaaaaatatcaaaatgaatacaattca
ggaaaattaagagttttgatgaaattactcaatcaaatcaaaattgagacaactagcgac
aaagttgtggtaatttctaattatacccaaactcttgacattattgaaaatttgatggca
tcggcgggtatgagttcgtgccgccttgatggatctaccccagcaaagcaaagggatgcg
attgtgaataattttaatcataatccatctatatttgcattccttttgagtgccaagtcc
ggtggtgtaggcctaaatttgatcggtgcttgtcgtttaattctgtttgacaacgactgg
aatccttcagtcgatttacaagcaatgtctagaatccacagagatggacagaagaagcca
tgctacatataccgcttggtaactactggttgcattgatgaaaaaattctgcaacggcag
ctcatgaagaattgtttgagtcaaaaatttctaagtgacacaaaaagtaccaaaggcagt
gcagatgatgaccttttcaataaagaagatttgaaagatttattcacagtattagtagat
acaccgagtaatactcacgatttgatctgctcctgcgagggtattggagaagaagttacc
ttacaagaccaccaagattcacaaaacaataagaattatgaaagttcacgcgagcataag
ctatcgaaatggaatagtgccttcgaggctcaaaaagtcatggaggagattgaagcgagt
gccagcaagagtaaggaatgcaatatcaagaaatgtttgattggatataaacacatcgat
ccaaacaaaactcatgatttattggacgacgtggctacagaggctctgaagagtcttcaa
aatgatataacttttgcatttgttcatcctggtgaaagccacctagaaggaacatcccat
aaataa

DBGET integrated database retrieval system