KEGG   Zygosaccharomyces rouxii: ZYRO0G16082gHelp
Entry
ZYRO0G16082g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
Organism
zro  Zygosaccharomyces rouxii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1320266..1321714)
Genome map
AA seq 482 aa AA seqDB search
MCDKIDRHTFKVFNQDFTVDKRFQLIKEIGHGAYGIVCSARFTEALEDTTVAIKKVTNIF
SKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIIFYPDGTFSGLYLYEELMECDMHQIIK
SGQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGKPIFKGKDYVN
QLNRILQVLGTPPDETLGRIGSKNVQDYIHQLGFIPKVPFVDIFPQANPQALDLLEKMLM
FDPEERITVEDALEHPYLSIWHDPADEPVCNEKFEFSFESINEMSELRQMVIREVQEFRQ
YVRQPLIEEQEWQHEQELQNKARDENELDASSGLNENDFTQQMLGGGPPSAQNPQLQESF
GIDSRDLPRHDTDFPPRPQENLLETPVELKQGANGTLGNQGGYGDFLDLEKELEFGLDKK
FM
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacaagatcgatagacatactttcaaggtttttaaccaggattttactgttgat
aagagatttcagttgatcaaggaaattggtcatggtgcctacgggatagtgtgttccgcc
agatttacagaggccctagaggataccacagtggcaattaagaaagtgacaaacattttt
tccaagacactactttgtaaaagatccttgagagaattgaaactgctcagacacttcaga
ggtcacaaaaacattacttgtctttatgatatggatattattttttatccggatgggact
ttctcagggttgtatctgtacgaagaactgatggagtgtgatatgcaccaaattattaaa
tctggtcagccattgacggatgcacattatcaaagttttatctatcaaatcctgtgtgga
ttgaaatacattcattctgcggatgttttgcacagagatttgaaacctggtaacctgctg
gtgaatgccgattgtcagttaaagatctgtgattttggtttggcaagaggttattctgaa
aatcctgttgaaaataaccaatttttaacggaatacgtggctacgagatggtacagagca
cctgaaattatgttatcttatcaaggttatacaaaggcgattgacgtttggtcaactggt
tgtattttagcggaatttctaggtggtaaaccaattttcaaaggtaaagattatgttaac
cagttgaatcgaatattacaagtgctcggtacaccacctgatgaaactctaggccgcatt
gggtctaaaaatgttcaagattatatccatcaattaggattcattcccaaggtaccattt
gtagatattttcccacaggcaaatccacaggctttagatctgctggaaaaaatgttgatg
tttgatccagaggaaagaattacggttgaagatgcattagaacacccatatttatccata
tggcatgatccagctgatgaacctgtttgtaatgagaaatttgaatttagctttgaaagt
attaatgaaatgagcgaattgaggcaaatggttattcgtgaagtacaagagtttagacag
tacgttagacagcctctaatagaagaacaagaatggcaacatgagcaagaattacaaaat
aaagctcgagacgaaaatgaattagatgcgagttcaggattgaacgaaaacgattttact
caacaaatgttaggtggcggacctccatccgcacaaaatccacaattgcaagaatctttt
ggtattgattctagagatttaccaagacatgatacagattttccaccaaggcctcaggag
aatctactagaaacaccagtagaattgaaacagggtgctaatggtactttaggaaatcag
ggcggttacggtgatttcttggatctagagaaagaattagaatttggtctcgacaaaaaa
tttatgtaa

DBGET integrated database retrieval system