KEGG   Zygosaccharomyces rouxii: ZYRO0G16742gHelp
Entry
ZYRO0G16742g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ZYRO0G16742g
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ZYRO0G16742g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ZYRO0G16742g
Lipid biosynthesis proteins [BR:zro01004]
 Desaturase
  First
   ZYRO0G16742g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1373818..1375449
Genome map
AA seq 543 aa AA seqDB search
MGDAIPEFDFSDLVSSAGFNNNEDSKECHVVAPEQTASSSGSFIKGRPSVNINANANVSD
GSSRQQGPVPSRKKDPHVVHLLKRISLQSTILCIIIPLFSLFKLILAPPKPINPLFIGFF
CVYTFLSQVALFAGYHRFFSHQSFQAHVLLQLVYSVFGGSVGLGSVLQFASQHMAHHRHQ
DTERDPHSFSVYGCLFSLWGHRFFLGNRKSRKAIKECRDTILSTSRMSRGKLSTTAASPD
ELIQPPNYELLVMQDKYYVKLLILTIVVIPCLVARYCGVPYWTGIYYLGFVKMSIIQQQW
LLLGTLAHIRNFPLATQPFSSIRSAINLPLSCLFQFLLFGEAKHNFHHEFPSDFTNGSRW
YHWDPAKWTIYLCQSLGLVNHLHVTDPQQSLKCFIQQQQKLLDEEHSKLKWGVSIDRLPS
MTSNQFVKLAIEQFAENKRALVVIEGIVHDVTPFIHDHPGGTALVQLSVGKDATHAFNGA
VYFHSKAARNLLATMRIAKLSSSERVQNTVWERRMLKDSRDQQRRNNRQITYTQKNHYAA
GAA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgccataccggaatttgattttagtgacttggtatcgtctgctggatttaat
aataacgaggattcgaaggagtgtcatgtggtagcaccagagcagactgcgagctcctca
gggagctttattaaaggtagaccttcagtaaatataaacgccaatgccaatgttagtgat
ggttcatcgcgacaacaggggccggtcccttcacgcaagaaagatccacacgttgtgcat
ttgttgaaacgtatcagtttgcaatctactattctgtgcatcataataccgttgttctcg
ttattcaagttgatattagcgccaccgaaaccaatcaacccgttattcattggattcttt
tgcgtatacactttcctatcgcaagtagcactgtttgctggttatcatagattctttagc
catcaatcgttccaggcacacgttttattacaattggtatattcggttttcggtggatct
gttggattaggttcagtcctacagtttgcaagccagcacatggcacatcatcgtcatcaa
gatacggaaagagatccacattccttttcagtctacggttgcttgttttctctatggggg
cacagattctttcttggtaataggaaatccagaaaggctattaaggaatgtagagatacc
attttatccacatcgaggatgagtcgtggtaagcttagtacaacggcagcatctccagat
gaattgatacaaccacctaactatgaattactagtcatgcaagataaatactatgtgaag
ctattgattttaacgattgttgtcattccatgtttagtggcacgttactgtggtgtgccc
tattggaccggtatatattatctgggatttgtcaaaatgtcaatcatacaacaacagtgg
ttattattgggtactttagcacatattagaaatttcccgttagcaacgcagccgttttcg
agcatcagatccgctatcaacttaccgctttcgtgcttgttccaatttcttctttttgga
gaagcgaagcataacttccaccacgaatttcctagtgattttactaatggttcacggtgg
taccattgggatccagctaaatggaccatctatttgtgtcaaagcttgggactcgttaac
catttacacgttacagatcctcaacaaagtctgaaatgctttattcagcagcaacagaaa
ttattggatgaggaacattccaagttaaaatggggggtctctatcgataggttaccttct
atgacgtccaaccaatttgttaaattggccattgaacaatttgccgaaaacaaaagagca
ttagttgtcattgaaggtattgttcacgatgtgactccattcattcatgatcacccaggt
ggtactgcattggtacagctcagcgtcggtaaagatgctacccatgcatttaatggtgcc
gtttatttccattctaaagctgccaggaaccttctagctacaatgagaattgctaagttg
agttctagcgagcgtgtccaaaacaccgtttgggagagaagaatgttgaaagatagtcgt
gatcagcaacggagaaataatagacagattacttatactcaaaagaaccattatgctgcc
ggtgcagcttaa

DBGET integrated database retrieval system