KEGG   Zygosaccharomyces rouxii: ZYRO0G17622gHelp
Entry
ZYRO0G17622g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ZYRO0G17622g
Peptidases [BR:zro01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   ZYRO0G17622g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1456443..1457156
Genome map
AA seq 237 aa AA seqDB search
MSGQEPSVVPLESNPEVFSDFAHGLGLDNSYGFVDIYSLTDPDLMAFTPAPVKALILLFP
LNDFFETSKDDASATEESQDEPVWFRQSIKNACGLYALLHSLSNNSQLLQKESKLLQYLQ
LHPSSGNRYADNPTDEFVLSISETNADRFQSGQSRAPDADEDVNLHFVTFVEKDGKIYEL
DGRRPQGARLLGNASKSPDEGLLGEKLVSDRVQWYMDKADEKNKLHFNLLGLAPSLD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacaagaaccatctgtcgtaccacttgaatctaatcctgaagttttcagtgat
tttgcccatgggttagggcttgataattcctatgggtttgtcgatatctattccctaacc
gatcccgacctaatggcttttacacccgctccagtgaaggcacttatactgttatttcca
ttgaatgatttctttgaaacttctaaggatgatgcatctgccactgaggaatctcaagat
gagcctgtttggttcagacagagtattaaaaatgcctgtggtctctatgcactattgcat
tctttgagtaacaactcacaactattacaaaaggaatctaagttgttgcaatatttacaa
ttacatccatccagtgggaacagatatgctgataatccaactgatgaatttgttttatcc
attagtgagaccaatgccgataggtttcaaagtggtcagtcgagagcacctgatgccgat
gaggatgtcaatctacattttgtaacgtttgttgaaaaagatggtaaaatctatgaacta
gacggtaggaggcctcagggtgccagacttttaggtaatgcaagtaagagtcccgatgaa
ggtctactaggtgaaaaacttgttagcgatagggttcaatggtatatggataaggctgat
gagaagaataaattacatttcaacttattaggcttagctccttccctagattaa

DBGET integrated database retrieval system