KEGG   Zygosaccharomyces rouxii: ZYRO0G18172gHelp
Entry
ZYRO0G18172g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ZYRO0G18172g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1495951..1497018)
Genome map
AA seq 355 aa AA seqDB search
MSFARIVNRRAIYFLGSVAAGATGAAGLASSDFNGSFFNGNNNNPKNNGSSWWKGLAGTS
AAAAPALRVAEVEKGKTPEDFQQVYNAIAKKIIDDDEYDNYIGYGPVLVRLSWHSAGTFD
KNDNSGGSYGGTYRFPKETNDPSNKGLQNAKAFLEPIYEQFPWISHGDLYTLGGVTALQE
MQGPKVPWRPGRVDLPESATPENGRLPDAENGADYVRNFFKRFGFTDQEVVALIGAHALG
KTHMANSGYEGPWGAATNTFSNEFFVNLLNEQWKKEKTEAGNSQYNSPSGFMMMPTDFAL
KEDNTYLKYVKKYAENQDVFFEDFKNAYKKLLENGIEFPEGTPTIVFKTLDEQEQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgcaagaattgtgaatagaagagctatctattttctaggtagtgtggcagct
ggtgccactggtgcagctggtctagcaagcagcgactttaacggcagttttttcaatggt
aacaacaacaaccctaaaaataacggcagtagctggtggaaaggtttagcaggtacaagt
gccgctgctgctcccgctttgcgtgttgctgaagtagaaaagggtaagacacctgaagat
ttccaacaagtttacaatgcaattgctaaaaaaataattgatgacgatgaatatgataac
tacattggttacggacctgtccttgtgcgtctatcatggcactcagctggtaccttcgat
aaaaacgataacagtggtggttcttacggtggtacttaccgtttccctaaggaaacaaat
gatccatccaacaaaggtttacaaaatgcaaaggctttcctagagccaatttacgaacaa
ttcccatggatctcacacggtgatctttacactctaggtggtgtcacagctttacaagag
atgcaaggtcctaaagtaccatggagaccaggtagagttgatttaccggaaagtgctacc
ccagaaaacggtagattaccagatgctgaaaatggtgctgattatgtgagaaacttcttc
aagagattcggctttactgaccaagaagtcgttgcactaataggtgctcatgctctaggt
aagacccacatggcaaattctggttatgaaggtccatggggtgcagctaccaacactttt
agtaatgaatttttcgtcaacttgttgaacgaacaatggaagaaagaaaagaccgaagct
ggtaacagtcaatacaactccccaagtggttttatgatgatgccaactgattttgcacta
aaggaagataacacttacttgaaatacgtcaagaaatacgctgaaaatcaagatgtgttc
ttcgaagatttcaagaatgcctacaagaaattactagaaaacggtattgaatttccagag
ggtacaccaacaattgtcttcaaaactttggacgaacaggaacaataa

DBGET integrated database retrieval system