KEGG   Zygosaccharomyces rouxii: ZYRO0G18502gHelp
Entry
ZYRO0G18502g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:zro00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    ZYRO0G18502g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     ZYRO0G18502g
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   ZYRO0G18502g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1528075..1529265
Genome map
AA seq 396 aa AA seqDB search
MSMDAGIATKDNGGQTLGQQGQEEHQNQGPVQQPEQEQQKKLEEQNEQNEQQQVQQVQQP
QGNSERDRKDAGRGRNTSGKYCLDDFQILRTLGTGSFGRVHLVRSNHNGRFYALKVLKKH
VIVKLKQVEHTNDERRMLSIVAHPFLIRMWGTFQDAEQVFMVMDYIEGGELFSLLRKSQR
FPNPVAKFYAAEVCLALEYLHLNDIIYRDLKPENILLDRNGHIKITDFGFAKYVPDVTYT
LCGTPDYIAPEVISTKPYNKSVDWWSFGIYIYEMLAGYTPFYDANAMKTYENILNAEIKF
PPFFHPDAQDLLSKLIMRDLSKRLGNLQNGTEDVKNHPWFSEVVWEKLLCRNIETPYEPP
IQQGQGDTSQFDRYPEEEINYGIAGHDPYDNLFDEF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatggatgctgggatagcgacgaaagacaatggagggcagactcttggccaacag
gggcaagaggagcatcagaaccaaggtcccgttcagcagcctgaacaggaacagcaaaag
aagctagaagaacaaaatgaacagaatgaacaacaacaagttcagcaagtacaacaaccc
caaggaaattcggaacgagatagaaaggatgcaggacgtggtagaaatacatcagggaaa
tactgtcttgatgatttccaaattctaagaacgttaggtacgggatcatttggcagagtg
catttagtccgttccaaccacaatggcagattctatgctttgaaagtgttaaagaaacat
gtcattgttaaattgaaacaggttgaacacacaaatgacgaacgtcgtatgctgtcgatt
gtggcacaccctttcttaattcgtatgtgggggacatttcaagatgctgaacaagttttc
atggtaatggattacatagaaggtggcgagcttttctcacttttaaggaaatctcaacgt
ttccccaacccagtggcaaaattctatgcagctgaagtctgtttggctctagaatactta
catttgaacgatatcatctacagagatttgaagcctgaaaatattttgttggacagaaat
ggtcacattaaaatcacagattttggtttcgccaaatacgttcctgatgtcacatatact
ctatgtggtacacctgattatatcgcacctgaagtaatcagtacaaaaccctacaacaaa
tctgttgattggtggtcatttggtatttatatctacgaaatgcttgcaggttacacacca
ttttatgatgcaaacgcaatgaaaacttatgaaaatattttaaatgcagaaataaaattt
ccaccatttttccaccctgatgctcaagaccttttatcgaaactaattatgagagatttg
agtaaaagattgggaaacttacaaaatggtacggaagatgttaaaaatcatccctggttc
agtgaagtggtttgggaaaaattactctgcagaaatattgaaacgccatacgaaccacca
attcaacaaggccaaggtgatacttcccaattcgataggtaccctgaagaagagattaat
tatggtatagcgggtcatgatccttacgacaacctgtttgacgaattttaa

DBGET integrated database retrieval system