KEGG   Zygosaccharomyces rouxii: ZYRO0G18502gHelp
Entry
ZYRO0G18502g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
Organism
zro  Zygosaccharomyces rouxii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
G:1528075..1529265
Genome map
AA seq 396 aa AA seqDB search
MSMDAGIATKDNGGQTLGQQGQEEHQNQGPVQQPEQEQQKKLEEQNEQNEQQQVQQVQQP
QGNSERDRKDAGRGRNTSGKYCLDDFQILRTLGTGSFGRVHLVRSNHNGRFYALKVLKKH
VIVKLKQVEHTNDERRMLSIVAHPFLIRMWGTFQDAEQVFMVMDYIEGGELFSLLRKSQR
FPNPVAKFYAAEVCLALEYLHLNDIIYRDLKPENILLDRNGHIKITDFGFAKYVPDVTYT
LCGTPDYIAPEVISTKPYNKSVDWWSFGIYIYEMLAGYTPFYDANAMKTYENILNAEIKF
PPFFHPDAQDLLSKLIMRDLSKRLGNLQNGTEDVKNHPWFSEVVWEKLLCRNIETPYEPP
IQQGQGDTSQFDRYPEEEINYGIAGHDPYDNLFDEF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatggatgctgggatagcgacgaaagacaatggagggcagactcttggccaacag
gggcaagaggagcatcagaaccaaggtcccgttcagcagcctgaacaggaacagcaaaag
aagctagaagaacaaaatgaacagaatgaacaacaacaagttcagcaagtacaacaaccc
caaggaaattcggaacgagatagaaaggatgcaggacgtggtagaaatacatcagggaaa
tactgtcttgatgatttccaaattctaagaacgttaggtacgggatcatttggcagagtg
catttagtccgttccaaccacaatggcagattctatgctttgaaagtgttaaagaaacat
gtcattgttaaattgaaacaggttgaacacacaaatgacgaacgtcgtatgctgtcgatt
gtggcacaccctttcttaattcgtatgtgggggacatttcaagatgctgaacaagttttc
atggtaatggattacatagaaggtggcgagcttttctcacttttaaggaaatctcaacgt
ttccccaacccagtggcaaaattctatgcagctgaagtctgtttggctctagaatactta
catttgaacgatatcatctacagagatttgaagcctgaaaatattttgttggacagaaat
ggtcacattaaaatcacagattttggtttcgccaaatacgttcctgatgtcacatatact
ctatgtggtacacctgattatatcgcacctgaagtaatcagtacaaaaccctacaacaaa
tctgttgattggtggtcatttggtatttatatctacgaaatgcttgcaggttacacacca
ttttatgatgcaaacgcaatgaaaacttatgaaaatattttaaatgcagaaataaaattt
ccaccatttttccaccctgatgctcaagaccttttatcgaaactaattatgagagatttg
agtaaaagattgggaaacttacaaaatggtacggaagatgttaaaaatcatccctggttc
agtgaagtggtttgggaaaaattactctgcagaaatattgaaacgccatacgaaccacca
attcaacaaggccaaggtgatacttcccaattcgataggtaccctgaagaagagattaat
tatggtatagcgggtcatgatccttacgacaacctgtttgacgaattttaa

DBGET integrated database retrieval system