KEGG   Zygosaccharomyces rouxii: ZYRO0G21758gHelp
Entry
ZYRO0G21758g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ZYRO0G21758g
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ZYRO0G21758g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ZYRO0G21758g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1790034..1790657
Genome map
AA seq 207 aa AA seqDB search
MLALSPSPYFRVLRSISSKTSFTSKSSIVESLRPSTNNSIRAMSSAASKFYGLEPLDKTG
KPFSFKQLEGKVVIIVNVASKCGFTPQYAGLEELYKKYKDEGLVILGFPCNQFLSQEPGS
DEQIGEFCKLNYGVTFPIMKKIDVNGKNVDPVYEFLKSQKSGTLGMTRIKWNFEKFLIDK
QGKVVERFSSLTKPSSIEPKVKELLGK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgttagctctctcccctagtccttatttcagggtgttgcgtagtataagttctaaaact
tcattcacatcaaagtctagtatagttgaatcgcttaggccatctacaaataattcaata
agagcgatgtcttcagcagcatctaagttttacggtttggagccattggacaagactggg
aaaccattctccttcaagcagttggaaggtaaagttgtcataatcgttaatgtagcatct
aagtgtggtttcacacctcagtatgctggattagaggaactttacaaaaagtacaaggat
gaaggcttagtcattttgggattcccttgtaaccaatttctaagtcaagaaccaggttca
gatgagcaaatcggtgaattttgcaagttgaactacggtgtgactttcccaattatgaag
aagatcgatgtcaacggtaagaacgttgatcctgtttatgagttcctcaagagccagaag
tccggtactttgggaatgacccgtatcaaatggaattttgaaaaattcctaattgataag
caaggtaaagttgtggagaggttctcttccttgactaagcctagctctattgaacctaag
gtaaaggaattgttaggcaaatga

DBGET integrated database retrieval system