KEGG   Zymoseptoria tritici: MYCGRDRAFT_100120Help
Entry
MYCGRDRAFT_100120 CDS       T02285                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ztr  Zymoseptoria tritici
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MYCGRDRAFT_100120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 111 aa AA seqDB search
MGKDSYSPGDPKKGANLFKTRCAQCHNLKEGEPNKIGPNLHGLFGRQTGQVEGFSYTDAN
KQKAITWEENTLFEYLENPKKYIPGTKMAFGGLKKAKDRNDLIKYLQDETK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagacagctactcaccaggtgacccaaagaagggtgccaacctcttcaagaca
agatgcgcccagtgccacaacctgaaggagggcgagcccaacaagatcggccctaacctt
cacggcctcttcggtcgccagaccggccaggtcgagggtttctcatacaccgatgcgaac
aagcaaaaggccatcacatgggaggagaacactctcttcgaatacctcgagaacccaaag
aagtacattcccggcaccaagatggctttcggtggactcaagaaggccaaggaccggaac
gatttgatcaaatacctccaggacgagaccaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system