KEGG   Zymoseptoria tritici: MYCGRDRAFT_100257Help
Entry
MYCGRDRAFT_100257 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ztr  Zymoseptoria tritici
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ztr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 216 aa AA seqDB search
MSGVKLHFLQASRCIRAAWQLHELDVPYEFTFAERINGTGPAPPEFKEKAKGLGKFPTLE
DGLETFYESGNICEYLCDKYDKQNRLLPAVGDPKRYKVLQWVHASEATFMLHGLAVLYAK
WNQKDGDVEKTVAGLSVNICKDLDYLESELGKSSGKFIVGDSLTAADIMMQFSVDFVLVR
ELGTKGKSWPNVDKWLEQCKSTPSYQEAVKNTGYKL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgtaaagcttcacttcctccaggcgtcgcgctgcattcgtgcggcatggcaa
cttcacgagctcgacgtgccgtacgagttcaccttcgcggagcgcatcaatggcactggt
cctgctccgcccgagttcaaggagaaagctaaagggctaggaaaatttcctacgctcgag
gacggattggaaacattctatgaaagcggcaatatctgcgaatatctctgtgacaagtac
gacaagcaaaaccgcctactcccagctgtcggcgacccgaaacggtacaaagtgctgcaa
tgggtgcacgcctcggaagcgaccttcatgcttcacggtcttgccgttctctacgcgaag
tggaaccagaaggatggtgatgtcgagaaaacagtcgcaggcttaagcgtgaacatctgc
aaggacttggactatctcgaaagcgagcttggcaagagtagtggcaagttcatcgtcgga
gattcgctcacggccgcggatatcatgatgcagttctcggtggactttgtgctcgtgcgg
gagctcggaacgaaaggaaagagctggccgaatgtcgacaagtggttggaacagtgcaag
tcgacgccgtcgtaccaggaggccgtgaagaatacgggctataagttgtag

DBGET integrated database retrieval system