KEGG   Zymoseptoria tritici: MYCGRDRAFT_100496Help
Entry
MYCGRDRAFT_100496 CDS       T02285                                 

Gene name
NAG1
Definition
N-acetyl-beta-D-glucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ztr  Zymoseptoria tritici
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYCGRDRAFT_100496 (NAG1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    MYCGRDRAFT_100496 (NAG1)
   00603 Glycosphingolipid biosynthesis - globo series
    MYCGRDRAFT_100496 (NAG1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    MYCGRDRAFT_100496 (NAG1)
   00511 Other glycan degradation
    MYCGRDRAFT_100496 (NAG1)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MYCGRDRAFT_100496 (NAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 576 aa AA seqDB search
MFLLRQLASVALFTASVCAVWPLPSNYTHGEEVLWIQQGQIDFSFNGQGNNPSGDYNGTS
SSQIVANAIERTKDNLFAKNFVPWRFRPRLSNFEPTLGSDSTYITTVSLVQTEADPSNVG
KPESDVDESYSLSMEASGKVTVTAKTSIGLLYGLTTFSQLFYKHSTNGQVYTQLAPVTIT
DSPKFKWRGLNVDTSRSYKTLEDLYRMIDALSFNKMNRLHWHITDSQSWPLEIPSLPEVA
DKGVYVNFQRYTPQDVQNVQQYGALHGVEVAIEIDNPGHTASIALSHPELIAAFNVQPKW
TTYCAQPPCGTLKLNSTGVYDFLQKLFDDLLPRVKPYSSYFHLGGDEVNKNSYNLDDTVG
SNESAVLQPLMQKYMDRNMKQVESYGLVPLVWEEMLLEWNLTLPKDTIVQTWQSDAAVAQ
TVAKGYRALAGNYNYWYLDCGRGQFLDFYPSNAAGFFPFSDYCAPLHNWRAMYAYDPLTG
VPENSTHLVLGGEVHIWSEQTDSANLDSMVWPRAAAAGEVLWSGAKDASGQNRSQVEASP
RFAEMRERLVARGIRADTSFQPFCTQNGTQCAYPEA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgttacgccaattggcctcggtcgctctcttcaccgcaagcgtgtgtgcggta
tggcctctgccatcgaactacacccatggcgaagaagtgctttggatacagcaaggtcag
atcgacttctcgttcaatgggcagggaaacaatcctagtggagactacaacggaacgtcc
tcttctcagatcgttgccaacgccatcgagcgaacgaaagacaatcttttcgcaaagaac
ttcgtcccgtggcgattccgacctcgcttgtcgaacttcgagccaaccttgggctcagac
tcaacttacatcaccacggtgtcccttgtgcagaccgaggcggatccctccaatgtcggc
aagcccgagagcgatgtcgacgaatcgtacagtctctccatggaagcgagcggcaaagtg
accgtcactgcgaagacttccatcggcctgctatacggactgacaactttctcccaactg
ttctacaagcactccaccaacggccaagtctacacacaactggctccagtcacgatcact
gactcgcccaagttcaagtggagaggcctgaacgtcgacacctcccgctcatacaagacg
ctcgaagacctgtaccgcatgatcgacgcactctccttcaacaagatgaaccgcctgcac
tggcacattaccgattcacagtcctggccactcgagatcccttccttgccagaagtggct
gacaaaggagtctacgtgaacttccagcgctacacacctcaagacgtgcaaaatgtccag
caatacggcgcccttcacggtgtcgaagtcgccatcgagattgataaccctggccacacc
gcttcgatcgccctttcccatccggaattgatcgcagcgttcaacgtccagcccaaatgg
acaacctactgcgcccagcctccctgcggaacactcaagctcaactccactggcgtgtac
gacttcctccaaaagctcttcgacgatctgcttccccgtgtaaagccgtacagcagctac
ttccatcttggcggcgatgaagtcaacaagaactcgtacaacctcgacgacacagtcgga
agcaacgaatccgcagtcctgcagccgctgatgcagaagtacatggaccgcaacatgaag
caggtcgagtcttacggcttggtgccgctcgtgtgggaggagatgttgctggagtggaac
ttgacgctacccaaggacaccatcgttcagacttggcagagcgatgcggcggtcgctcag
accgtggccaagggataccgcgcgctggctggtaactacaactactggtacctggactgt
ggtcgcggccagttcttggacttctatccttccaacgcggctgggttcttcccgttctcg
gactactgtgcgcccctccacaactggcgtgcgatgtacgcgtacgatccactcactggc
gtgccggagaattcgacgcatttggtgctgggaggagaggtgcacatctggtccgagcag
acagattccgccaaccttgattccatggtctggccgcgtgctgccgcggccggtgaagtt
ctttggagtggtgcgaaggacgcctcgggtcagaaccgctcgcaggtcgaggcttctccc
agattcgcggagatgagggagcgcttggtcgcgagaggcatcagggcggacacgtcgttc
cagccgttctgcacgcagaatggcacgcagtgtgcgtatcccgaagcctag

DBGET integrated database retrieval system