KEGG   Zymoseptoria tritici: MYCGRDRAFT_100496Help
Entry
MYCGRDRAFT_100496 CDS       T02285                                 

Gene name
NAG1
Definition
N-acetyl-beta-D-glucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ztr  Zymoseptoria tritici
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ztr00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ztr00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ztr00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ztr00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 576 aa AA seqDB search
MFLLRQLASVALFTASVCAVWPLPSNYTHGEEVLWIQQGQIDFSFNGQGNNPSGDYNGTS
SSQIVANAIERTKDNLFAKNFVPWRFRPRLSNFEPTLGSDSTYITTVSLVQTEADPSNVG
KPESDVDESYSLSMEASGKVTVTAKTSIGLLYGLTTFSQLFYKHSTNGQVYTQLAPVTIT
DSPKFKWRGLNVDTSRSYKTLEDLYRMIDALSFNKMNRLHWHITDSQSWPLEIPSLPEVA
DKGVYVNFQRYTPQDVQNVQQYGALHGVEVAIEIDNPGHTASIALSHPELIAAFNVQPKW
TTYCAQPPCGTLKLNSTGVYDFLQKLFDDLLPRVKPYSSYFHLGGDEVNKNSYNLDDTVG
SNESAVLQPLMQKYMDRNMKQVESYGLVPLVWEEMLLEWNLTLPKDTIVQTWQSDAAVAQ
TVAKGYRALAGNYNYWYLDCGRGQFLDFYPSNAAGFFPFSDYCAPLHNWRAMYAYDPLTG
VPENSTHLVLGGEVHIWSEQTDSANLDSMVWPRAAAAGEVLWSGAKDASGQNRSQVEASP
RFAEMRERLVARGIRADTSFQPFCTQNGTQCAYPEA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgttacgccaattggcctcggtcgctctcttcaccgcaagcgtgtgtgcggta
tggcctctgccatcgaactacacccatggcgaagaagtgctttggatacagcaaggtcag
atcgacttctcgttcaatgggcagggaaacaatcctagtggagactacaacggaacgtcc
tcttctcagatcgttgccaacgccatcgagcgaacgaaagacaatcttttcgcaaagaac
ttcgtcccgtggcgattccgacctcgcttgtcgaacttcgagccaaccttgggctcagac
tcaacttacatcaccacggtgtcccttgtgcagaccgaggcggatccctccaatgtcggc
aagcccgagagcgatgtcgacgaatcgtacagtctctccatggaagcgagcggcaaagtg
accgtcactgcgaagacttccatcggcctgctatacggactgacaactttctcccaactg
ttctacaagcactccaccaacggccaagtctacacacaactggctccagtcacgatcact
gactcgcccaagttcaagtggagaggcctgaacgtcgacacctcccgctcatacaagacg
ctcgaagacctgtaccgcatgatcgacgcactctccttcaacaagatgaaccgcctgcac
tggcacattaccgattcacagtcctggccactcgagatcccttccttgccagaagtggct
gacaaaggagtctacgtgaacttccagcgctacacacctcaagacgtgcaaaatgtccag
caatacggcgcccttcacggtgtcgaagtcgccatcgagattgataaccctggccacacc
gcttcgatcgccctttcccatccggaattgatcgcagcgttcaacgtccagcccaaatgg
acaacctactgcgcccagcctccctgcggaacactcaagctcaactccactggcgtgtac
gacttcctccaaaagctcttcgacgatctgcttccccgtgtaaagccgtacagcagctac
ttccatcttggcggcgatgaagtcaacaagaactcgtacaacctcgacgacacagtcgga
agcaacgaatccgcagtcctgcagccgctgatgcagaagtacatggaccgcaacatgaag
caggtcgagtcttacggcttggtgccgctcgtgtgggaggagatgttgctggagtggaac
ttgacgctacccaaggacaccatcgttcagacttggcagagcgatgcggcggtcgctcag
accgtggccaagggataccgcgcgctggctggtaactacaactactggtacctggactgt
ggtcgcggccagttcttggacttctatccttccaacgcggctgggttcttcccgttctcg
gactactgtgcgcccctccacaactggcgtgcgatgtacgcgtacgatccactcactggc
gtgccggagaattcgacgcatttggtgctgggaggagaggtgcacatctggtccgagcag
acagattccgccaaccttgattccatggtctggccgcgtgctgccgcggccggtgaagtt
ctttggagtggtgcgaaggacgcctcgggtcagaaccgctcgcaggtcgaggcttctccc
agattcgcggagatgagggagcgcttggtcgcgagaggcatcagggcggacacgtcgttc
cagccgttctgcacgcagaatggcacgcagtgtgcgtatcccgaagcctag

DBGET integrated database retrieval system