KEGG   Zymoseptoria tritici: MYCGRDRAFT_101210Help
Entry
MYCGRDRAFT_101210 CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00010  Glycolysis / Gluconeogenesis
ztr00071  Fatty acid degradation
ztr00350  Tyrosine metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCGRDRAFT_101210
  Lipid metabolism
   00071 Fatty acid degradation
    MYCGRDRAFT_101210
  Amino acid metabolism
   00350 Tyrosine metabolism
    MYCGRDRAFT_101210
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MYCGRDRAFT_101210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 adh_short 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 13402518
NCBI-ProteinID: XP_003849721
JGI: Mycgr3_101210
UniProt: F9XK72
Position
9
AA seq 352 aa AA seqDB search
MGDIPTEQWAQVVEKTGGPVVYKKIPVQKPGPDEVLVNIKYSGVCHTDLHAVNGDWPLPT
KLPLVGGHEGAGVVVAKGDLVQDIEIGDYAGVKWINGSCLACDFCQQSDEPLCSKALLSG
YTVDGSFQQYCIAKGAHVARIPKECKLDEISPILCAGITVYKGLKESGAKPGQTVAIVGA
GGGLGSLAQQYARAMGLRTIAIDTGDDKKKMCLEQLGSYAFVDFAQSQNVVKDVQAATED
GLGPHAVILVAVNEKPFQQAAEYVRPRGTVVCIGLPAGAFLKAPVFESVIKMVTIKGSYV
GNRKDSSEAIEFYRRGLIKAPFKTVGLSELQSVYDLMQKGAIAGRYVVDTSK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatccctaccgagcagtgggcccaagttgtcgagaagaccggcggaccagtc
gtctacaagaaaattcccgtccagaagcctggcccagatgaggtgcttgtcaacatcaag
tactccggcgtctgccacacagacttgcacgccgtcaatggtgactggccactgcccaca
aaactcccactcgtcggtggtcatgagggtgccggtgttgttgtagccaaaggcgacttg
gtgcaagatattgaaatcggtgactatgccggcgtgaaatggatcaacggctcctgcctc
gcctgcgacttctgccaacaatccgacgaacccctctgcagcaaggctctcctctccggc
tacaccgtcgacggctccttccagcaatactgcatcgccaagggcgcccacgtcgctcgc
atcccaaaggagtgcaagttggacgaaatttcgcccatcctttgcgctggcatcaccgtc
tacaagggcttgaaggagtcaggtgcgaagccaggccaaaccgtcgctatcgttggtgcg
ggcggtggtctgggatcgctggcgcagcagtacgctcgcgccatgggtctccggacgatt
gcgatcgacactggtgatgacaagaagaagatgtgcttggagcaactcggctcgtacgcc
tttgtcgactttgcgcagtcgcagaatgtggtcaaggatgtccaggccgctactgaggat
ggtcttggtccacatgctgtcatccttgtggctgtcaacgagaagccgttccagcaggct
gctgagtacgtccgccctcgcggcacagtcgtctgcatcggtctacccgctggtgcattc
ctcaaggctcccgtcttcgagtcggtcatcaagatggtcaccatcaagggctcctacgtc
ggcaaccgcaaagactcctcggaagccatcgagttctaccgccgcggcctcatcaaggcg
ccgttcaagacggtcggtctgtcggagctgcagagtgtgtatgatttgatgcagaagggc
gctatcgctgggcgatacgttgtggacacctcgaagtaa

DBGET integrated database retrieval system