KEGG   Zymoseptoria tritici: MYCGRDRAFT_101210Help
Entry
MYCGRDRAFT_101210 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ztr01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ztr00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ztr00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ztr00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 352 aa AA seqDB search
MGDIPTEQWAQVVEKTGGPVVYKKIPVQKPGPDEVLVNIKYSGVCHTDLHAVNGDWPLPT
KLPLVGGHEGAGVVVAKGDLVQDIEIGDYAGVKWINGSCLACDFCQQSDEPLCSKALLSG
YTVDGSFQQYCIAKGAHVARIPKECKLDEISPILCAGITVYKGLKESGAKPGQTVAIVGA
GGGLGSLAQQYARAMGLRTIAIDTGDDKKKMCLEQLGSYAFVDFAQSQNVVKDVQAATED
GLGPHAVILVAVNEKPFQQAAEYVRPRGTVVCIGLPAGAFLKAPVFESVIKMVTIKGSYV
GNRKDSSEAIEFYRRGLIKAPFKTVGLSELQSVYDLMQKGAIAGRYVVDTSK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatccctaccgagcagtgggcccaagttgtcgagaagaccggcggaccagtc
gtctacaagaaaattcccgtccagaagcctggcccagatgaggtgcttgtcaacatcaag
tactccggcgtctgccacacagacttgcacgccgtcaatggtgactggccactgcccaca
aaactcccactcgtcggtggtcatgagggtgccggtgttgttgtagccaaaggcgacttg
gtgcaagatattgaaatcggtgactatgccggcgtgaaatggatcaacggctcctgcctc
gcctgcgacttctgccaacaatccgacgaacccctctgcagcaaggctctcctctccggc
tacaccgtcgacggctccttccagcaatactgcatcgccaagggcgcccacgtcgctcgc
atcccaaaggagtgcaagttggacgaaatttcgcccatcctttgcgctggcatcaccgtc
tacaagggcttgaaggagtcaggtgcgaagccaggccaaaccgtcgctatcgttggtgcg
ggcggtggtctgggatcgctggcgcagcagtacgctcgcgccatgggtctccggacgatt
gcgatcgacactggtgatgacaagaagaagatgtgcttggagcaactcggctcgtacgcc
tttgtcgactttgcgcagtcgcagaatgtggtcaaggatgtccaggccgctactgaggat
ggtcttggtccacatgctgtcatccttgtggctgtcaacgagaagccgttccagcaggct
gctgagtacgtccgccctcgcggcacagtcgtctgcatcggtctacccgctggtgcattc
ctcaaggctcccgtcttcgagtcggtcatcaagatggtcaccatcaagggctcctacgtc
ggcaaccgcaaagactcctcggaagccatcgagttctaccgccgcggcctcatcaaggcg
ccgttcaagacggtcggtctgtcggagctgcagagtgtgtatgatttgatgcagaagggc
gctatcgctgggcgatacgttgtggacacctcgaagtaa

DBGET integrated database retrieval system