KEGG   Zymoseptoria tritici: MYCGRDRAFT_101232Help
Entry
MYCGRDRAFT_101232 CDS       T02285                                 

Gene name
HAM2402
Definition
histone acetyltransferase, MYST family
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCGRDRAFT_101232 (HAM2402)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 521 aa AA seqDB search
MAPHGDNKHGGSGGDDVKPERGMATLSTLRIGTKAMVKKSDETRKAEILSMQTRKGLPTF
YVHYEDFNKRLDEWVSADRLDLTQEVEWPIPEKPDNKTKQKTAQQSKSQQQSKTDSKSQT
KAGQKRSRSGTATREASATPDVPAKLSRHPSKAGGKENRDPLPTVAVEDVDAGTPQPDDE
SAVDLVDMQEAAASAKAIPDTVPYSREEEIEKLRTGGSMTQNQTEISRVRNLERVQMGNH
EIEPWYFSPYPAEFTDCDMVYICEFCLCYFGSNFQFKRHRGKCQLFHPPGNEIYRDDNVS
FFEIDGRRQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTTRSEHGHHLIGYFSKEKE
SAEGYNVACILTLPQHQRKGYGALLIQFSYELSKIEGKLGSPEKPLSDLGLLGYRAYWQE
MIVDVLLEREAENPGSTGGIAVEELGATLAMTTNDVLHTLQNLNMLRYSQKNHVIVLTDA
VVAARERRKEKEKIKGKRLIEPEKLIWKPPVFAASARTWNW
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcacggtgataacaagcatggcggaagtggaggagatgatgtcaaaccagag
cgaggcatggccacgctttcgacattaagaatcgggaccaaggccatggtcaagaagagc
gacgagacacgcaaagcagagatcctttccatgcagacaagaaaaggtctcccaaccttc
tacgtccactacgaagacttcaacaaacgtctcgacgaatgggtctctgcagatcggctt
gacctcacacaagaagtcgagtggcccatcccggagaagcctgacaacaagaccaagcag
aagactgctcagcagtccaagtcccaacaacaatccaagaccgactcgaaatcacaaacg
aaagctggacagaaacggtcgagaagcgggacagccacgcgagaagcctccgctacgcca
gacgtccccgcgaaactatcacgacatccttcaaaggcaggcggaaaggagaatcgtgat
cctctccctacggttgctgtagaagatgtcgatgccggcactccgcagcccgatgatgag
tctgccgtcgatctcgttgacatgcaagaagccgcggcgtccgcgaaagctattcccgac
acagtcccctactcccgtgaagaagaaatagaaaagctccggaccggaggtagtatgacc
cagaatcaaaccgaaatcagccgcgtccgcaacttggagcgagttcaaatgggcaatcat
gagattgagccgtggtacttctccccctatccagccgaattcaccgactgcgacatggtc
tatatttgcgagttctgcctctgctactttggcagcaattttcagttcaaacgccatcgc
ggaaagtgccagctgttccatcctcctggcaatgagatctaccgcgacgacaacgtctcc
ttcttcgaaatcgacggtcggaggcaaaggacatggtgtcgcaacctctgcttactgtcc
aaactcttcctcgaccacaagaccctctactacgacgtcgaccccttcctcttctactgc
atgaccacccgttccgagcacggccaccaccttatcggatacttctccaaagaaaaggag
tccgcagaaggctacaacgtggcctgtattctcaccctcccacaacatcagcgaaaaggc
tacggcgccctcctcatccaattctcctacgaactctccaaaatcgaaggcaaacttgga
tccccagagaaacccctgtccgatctcggtctgctcgggtacagggcttactggcaggaa
atgatcgtcgacgtcctcctcgagcgggaagcggagaaccccggcagcacgggtggtatc
gcggtggaagagctgggcgccacgctggcgatgacgacgaatgatgtgctgcatacgttg
cagaatttgaatatgctgaggtatagccagaagaaccatgtgattgtgttgacggatgcg
gtggtcgcggcgagggagaggaggaaggagaaggagaagattaaggggaagaggttgatt
gagccggagaagttgatttggaaaccgcctgtttttgcggcgagtgcgaggacgtggaat
tggtag

DBGET integrated database retrieval system