KEGG   Zymoseptoria tritici: MYCGRDRAFT_101365Help
Entry
MYCGRDRAFT_101365 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MYCGRDRAFT_101365
Enzymes [BR:ztr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MYCGRDRAFT_101365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 363 aa AA seqDB search
MLRFTQLFTAALVVVSTSAAAVVDLTPSNFDSIVLKSGKPALVEFFAPWCGHCKTLAPIY
EELAGSFASSTDKITIAKVDADEHKSLGTKYGIKGFPTIKYFDGSGKSEPEDYKKGRDID
SLTEFITEKIGVKPKGAKKVASSVEMLNDSTFDKQIGGDMDAIVAFTAPWCGHCKSLAPI
WETVAADFASEPSVLIAKVDADAPNGKKTAERYEVRSYPTILYFPKGSKDAVPYTGGRTE
ADLVTFMNEKAGTFRSPGGGLNALAGVIPSLDEAVAALKTGGEKAYKELAKQAGALQDKT
AEYYAKVASKAENNAGYLEKEYTRLQNLIGKGNLAPEKLDDLISRKNILSRFIGQEDDAK
SEL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgattcacgcaacttttcactgcggcgctcgtcgtagtcagcacctctgctgcc
gctgtcgtcgacctcacgccctcaaacttcgactccatcgtgctcaagtccggcaagcca
gcgcttgtcgagttctttgcaccatggtgcggccactgcaagactctcgctcccatctac
gaagagctcgcgggttccttcgcgtcttccacagacaaaatcaccatcgccaaagtcgac
gccgacgagcacaagtcgctgggaacgaaatacggaatcaagggatttcccacgatcaag
tactttgatggcagcgggaagtcggagccagaggattacaagaagggccgggatatcgac
agcttgactgagttcatcaccgagaagatcggcgtcaagccaaagggtgcgaagaaggtt
gcatcgtcagtcgagatgttgaacgacagcacttttgacaagcagattggcggtgacatg
gatgccattgtcgctttcacagcgccgtggtgtggacactgcaagagcctcgccccaatc
tgggagacggtcgccgccgacttcgcctccgagccctccgttcttatcgccaaggtcgac
gccgatgcacccaatggcaagaaaaccgctgagcgctacgaggtcaggtcctacccaaca
attctgtacttccccaagggttcgaaagacgcagtaccatacacgggcggacgtaccgag
gccgatttggtgaccttcatgaacgaaaaggctggaactttccgctctccaggcggtggt
ctcaacgctctggccggtgtcatcccatcgctcgacgaggccgttgcggccttgaagacc
ggcggcgagaaggcgtacaaggagctggccaagcaagccggcgcgctgcaggacaagacc
gctgagtactacgccaaggttgcgagcaaggctgaaaacaacgcgggatacctcgagaag
gaatacacaaggttgcagaacctgatcggcaagggcaaccttgcgccggagaagctggac
gatctgatcagccgcaagaacattttgagcaggttcatcggccaggaggacgatgcgaag
agcgagctttag

DBGET integrated database retrieval system