KEGG   Zymoseptoria tritici: MYCGRDRAFT_101587Help
Entry
MYCGRDRAFT_101587 CDS       T02285                                 

Gene name
MgPDI
Definition
PDI precursor protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MYCGRDRAFT_101587 (MgPDI)
Enzymes [BR:ztr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MYCGRDRAFT_101587 (MgPDI)
Exosome [BR:ztr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MYCGRDRAFT_101587 (MgPDI)
  Exosomal proteins of colorectal cancer cells
   MYCGRDRAFT_101587 (MgPDI)
  Exosomal proteins of bladder cancer cells
   MYCGRDRAFT_101587 (MgPDI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 508 aa AA seqDB search
MRYSLGLMGLAALAAASDVADLNKDTFPAFIKDNDLVLAEFFAPWCGHCKALAPEYEEAA
TTLKEKNIALAKVDCTEHQDLCQEYGVEGYPTLKIFRGADNVAPYSGPRKAQAIVSYMTK
QQLPAVSELTTSTALDEFKTADKIVIVGYFAADDKKSNATFNEVAEAHRDSYLFGATSDV
ALAEAEGAVQPSIVLYKTFDEGKNTFAEKFDKKAIEEWAKTSATPLIGEVGPETYSDYMA
AEIPLAYIFAETPEEREEFAKDLKPVAEAYKGKINFATIDAGSFGQHASNLNLAYPYADA
GSAKKLSAKNIGKFVKDFVAGKIEPSIKSEPIPEKQEGVHVVVAKNYQEVVIDSKQDVLL
EFYAPWCGHCKSLAPKYDELAGLYKPHLDKIIIAKVDATANDVPDEIQGFPTIKLFKAGS
KDAPIAYDGDRSIADLSKFIKENGSSGVYVEYIEPEVSDPVDTEGMPAQAAAATEKAKEG
VKEKVKEAAQAAYEAVTGDEDLDEHDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcgttactcactcggtcttatgggccttgctgccctggcggctgcatcggatgtcgcc
gacctgaacaaggacaccttcccggccttcatcaaggacaacgacctcgtcctcgccgag
ttcttcgcgccatggtgcggtcactgcaaggcgctcgcgccagaatacgaggaggctgcc
acgacattgaaagagaagaacatcgcattggccaaggtcgactgcaccgagcaccaagat
ctgtgccaggagtacggcgtggagggatacccaaccctcaagatcttccgcggcgcggac
aacgttgctccatactcgggccctcgcaaggctcaggccattgtctcatacatgaccaag
cagcagctacctgctgtgtcggagctcaccacctcgaccgctctcgatgagttcaagacc
gccgacaagattgtcattgttggctacttcgccgccgatgacaagaagtccaacgctacc
ttcaacgaggtcgccgaggcgcaccgtgactcttacctcttcggtgctacttctgatgtc
gctctcgccgaggcagagggtgccgtccagccatccattgtcctttacaagaccttcgat
gagggcaagaacaccttcgcggagaagtttgacaagaaagccatcgaggagtgggcgaag
acctctgctactccattgatcggcgaggtcggcccagagacctactctgactacatggct
gccgaaattcctctcgcctacatcttcgccgagaccccagaggagcgtgaggagttcgcc
aaggacctcaagccagtcgctgaggcgtacaagggcaagatcaacttcgctaccattgac
gccggctctttcggccagcacgctagtaacctcaacctcgcgtacccatacgccgacgcc
ggttccgccaagaagctcagcgcaaagaacattggaaaattcgtcaaggacttcgttgct
ggcaagattgagccatccatcaagagcgagccgatcccagagaagcaggagggtgtccac
gtcgtcgtggccaagaactaccaggaggtcgtcatcgacagcaagcaggatgttctcctc
gagttctacgctccatggtgcggacactgcaagtcgcttgctcccaagtacgacgagctc
gccggcctgtacaagcctcacctcgacaagatcatcatcgccaaggtcgacgctaccgcc
aacgacgtcccagacgagatccagggtttccctaccatcaagctcttcaaggctggctcc
aaggacgctccaattgcctacgacggcgaccgctccattgcggatctctccaagttcatc
aaggagaacggatcttccggcgtctacgtcgagtacattgagcccgaggtttccgatccc
gttgacaccgagggcatgcctgcgcaagctgctgccgctactgagaaggccaaggagggc
gtcaaggagaaggtcaaggaggccgctcaggccgcttacgaggctgtgactggtgatgag
gacctcgatgagcacgacgagctttag

DBGET integrated database retrieval system