KEGG   Zymoseptoria tritici: MYCGRDRAFT_102083Help
Entry
MYCGRDRAFT_102083 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCGRDRAFT_102083
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MYCGRDRAFT_102083
Enzymes [BR:ztr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MYCGRDRAFT_102083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 537 aa AA seqDB search
MSGSDAEQAKFEAEVKELKQWWQDPRWRYTRRPYTAESIVSKRGTIAIEYPSNQMSKKLW
DLVETRFKNKTASATYGCLDPVMVTQMAKYLDTVYVSGWQSSSTASASNEPGPDLADYPY
TTVPNKVEHLFMAQLFHDRKQREERLSTPPSQRSKVANTDFLRPIVADADTGHGGLTAVM
KLTKLFVEKGAAGIHIEDQMPGTKKCGHMAGKVLVPVSEHINRLVAIRAQADIMGVDLLA
VARTDSEAATLLTSTIDPRDHSYILGATNPALQPLNDLMLAAEAAGKYGAELQAVEDAWN
AQAGIKLFHEAVADTVNAGVHVDKQGLIDAFNAQSKGKSNAEQRALAKGLTGVDVHFDWD
SPRTREGYYRYRGGCQCAVMRANAYAPYADMIWMESKLPDFAQAKEFAEGVHAVWPEQKL
AYNLSPSFNWKAAMPAAEQETYIKRLASLGYCWQFITLAGLHSTALISDRFAKQYAQNGM
RAYGAIVQEPEIEEGCEVVTHQKWSGANYVDGLLQMVQGGMSSTSAMGAGVTEDQFK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccgacgcagaacaggccaagttcgaggccgaggtgaaagagttgaagcaa
tggtggcaggacccaagatggcgttacactcgccgtccctacaccgccgagtcaattgtc
tccaagcgtggaaccattgccattgaataccccagcaaccagatgtccaagaagctctgg
gatttggtcgagacacgcttcaagaacaaaaccgccagcgccacctacggatgtctcgac
ccagtaatggtcactcaaatggccaagtacctcgacaccgtctacgtctccggatggcaa
tcctccagcacggcctcggcctccaacgagcccggtcccgatcttgccgactacccatac
accaccgtccccaacaaggtcgagcacctgttcatggcccagctcttccacgaccgcaag
cagcgcgaggagcgcctcagcacaccaccttcgcaacgctccaaggtggccaacaccgac
tttctccgccccatcgtggccgacgccgacaccggtcacggaggtctcaccgccgtgatg
aagctcaccaagctcttcgtcgagaagggtgcggcagggatccacattgaggaccaaatg
cccggcacaaagaagtgcggccacatggcgggtaaagtcctcgtccccgtcagcgagcac
atcaaccgtctcgtcgccattcgcgcccaagccgacatcatgggcgtggacctcctcgcc
gtggcccgcaccgactccgaagccgccaccctcctcacctccaccatcgacccccgcgat
cactcctacatcctcggcgccaccaacccagctctccagcctctcaacgacctcatgctc
gccgccgaggccgcaggcaagtacggagccgaactccaagcggtcgaagacgcctggaac
gctcaggcggggatcaagctcttccacgaagccgtggccgacaccgtcaacgcgggcgtg
cacgtcgacaagcagggtctgattgacgctttcaacgcgcagtccaagggcaagtccaac
gccgagcagcgcgctctcgccaaaggtctcactggtgtggacgtccacttcgactgggat
tcccccagaacccgtgagggatactaccgctaccgcggaggttgccagtgcgccgtcatg
cgcgcgaacgcttacgctccgtacgccgacatgatttggatggagagcaagctgcccgat
ttcgcgcaggcgaaggagttcgctgagggtgtgcacgccgtgtggcccgagcagaaactc
gcctacaacctctccccctccttcaactggaaagccgccatgcccgccgccgagcaagaa
acctacatcaagcgcctcgcctccctcggctactgctggcaattcatcaccctcgccggt
ctgcacagcacggccctcatctccgaccgcttcgcgaagcagtacgcccagaacggcatg
cgtgcctacggcgccattgtgcaagagccggagattgaggagggttgtgaagtcgtcacg
caccagaagtggagtggtgcgaattatgtggatggtttgttgcagatggtgcagggtggt
atgagttcgacgagcgccatgggagcgggtgttacggaggatcagttcaagtag

DBGET integrated database retrieval system