KEGG   Zymoseptoria tritici: MYCGRDRAFT_102121Help
Entry
MYCGRDRAFT_102121 CDS       T02285                                 

Gene name
MgSlt2
Definition
(RefSeq) mitogen-activated protein kinase
Organism
ztr  Zymoseptoria tritici
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 414 aa AA seqDB search
MGDLQGRKVFKVFNQDFIVDERYTVTKELGQGAYGIVCAATNNQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKASDVWSVGCILAELLGSKPFFKGRDYVDQLNQ
ILHYLGTPSESTLARIGSPRAQEYVRNLPYMQKIPFHTLFRNANPDALDLLDRMLAFDPS
QRIDVDEALEHRYLSIWHDASDEPNCPTTFDFGFEVVEEVPEMRQMILQEVRQFRQSVRA
PQQQQYSQGHQQGQQVPIPDGYDRTHEDPRPQEMGSTDPYGLERELHDGLDAMR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacctacaaggccgcaaggtcttcaaggtgttcaaccaggacttcatcgtggac
gagcggtacactgtgacaaaagagctggggcagggcgcgtacggcattgtgtgtgctgcg
acgaacaatcagacgggcgaaggtgtggccatcaagaaggtcaccaatgtcttcagcaaa
aagatcctggccaagcgggcattgagagagatcaagctgctgcaacatttccgagggcac
cgaaacatcacttgtttgtatgacatggacattccgagaccggacaacttcaacgagacg
tacttgtacgaagagctcatggagtgcgatctggcagcgatcatccgatcaggacagcct
ctgactgacgctcacttccaatctttcatctaccagattctttgcggtctcaagtacatt
cacagcgcgaatgtgctccaccgtgatttgaagccgggcaatttgctggtcaatgccgac
tgcgagctgaagatttgcgattttggtctggcaagaggcttcagcgtagacccagaggag
aacgcaggatacatgaccgagtatgttgctacgagatggtacagagcgcctgagatcatg
cttagtttccagagctacacaaaagctagtgacgtctggtccgttggatgcattcttgcc
gaattgttgggcagcaagcctttcttcaagggccgtgactatgtcgaccagctgaaccag
attcttcactacctcggaacaccgtctgagtccacattggcccgcatcggatctcctcgt
gcacaggaatacgttcgcaacctgccgtacatgcagaagattcccttccacactctgttc
cgcaatgccaatccggatgccttggatctgctcgaccgcatgttggccttcgacccaagc
caacgtatcgacgtggatgaagctctcgagcaccgctatctctccatctggcacgacgcc
tcggacgagccaaactgcccgactacattcgactttggcttcgaggttgtggaggaggtt
ccggaaatgcgccaaatgattttgcaagaagtcagacagttccgtcaatccgtacgagcg
ccgcaacagcaacaatactcacaagggcatcaacagggtcaacaggtgccgatacctgat
ggctacgatcgcacgcacgaggatcccagaccgcaggagatgggaagcacggatccttat
ggcttggaaagggagcttcacgacggcttggacgccatgcgatag

DBGET integrated database retrieval system