KEGG   Zymoseptoria tritici: MYCGRDRAFT_102384Help
Entry
MYCGRDRAFT_102384 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ztr  Zymoseptoria tritici
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MYCGRDRAFT_102384
Translation factors [BR:ztr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MYCGRDRAFT_102384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 252 aa AA seqDB search
MAEVAKNPSEPVDLSTIPISPDGAMTDATNGATNGEKSANSGDVVTVFDDPSNFNVKHQL
QHTWTLWFTKPPSGKQDWNELLKEVISFNSVEEFWGIYNNITPASELAQKSDYHLFKQGV
RPEWEDQQNKHGGRWAYTYKGTKASDETWLNIMLAAIGEMLEDESDNEVMGVVVNIRKAF
WRVGLWTRTAGQAPKGRKDEAADPLESRKRLERIGKNFKDVLDLQPNEVIEFSGHADSAH
TGSSRAKAKFTV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtcgcaaagaacccatccgagcctgtggatctcagcaccattcctatctca
cctgacggtgccatgactgacgccacgaatggcgcgaccaatggcgagaagagtgccaac
agcggcgacgtcgtcacagtcttcgacgacccttcgaacttcaatgtcaagcaccagctg
cagcacacgtggacgctgtggttcaccaagccaccgagcggcaagcaggactggaacgag
ctgctcaaggaagtcatcagcttcaacagcgttgaggagttctggggcatctacaacaac
atcacaccagcatccgagctcgcgcagaagtccgactaccacctcttcaagcagggcgtg
cgaccagagtgggaggaccagcaaaacaagcacggtggacgctgggcatacacttacaag
ggcacaaaggccagtgacgagacctggctcaacatcatgctcgccgcgattggcgagatg
ctcgaggatgagagcgacaacgaggtgatgggagtcgtggtcaacatccgcaaggcattc
tggcgtgtgggtctgtggaccagaaccgctggccaggcgcccaagggccgcaaggatgag
gctgcggatccgctcgagagccgtaagcgtcttgaacgtatcggcaagaacttcaaggac
gtgctcgacctgcagccaaacgaggtgattgagttcagcggtcacgctgattctgctcac
accggtagcagccgtgcgaaggccaagttcaccgtctag

DBGET integrated database retrieval system