KEGG   Zymoseptoria tritici: MYCGRDRAFT_103402Help
Entry
MYCGRDRAFT_103402 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ztr  Zymoseptoria tritici
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ztr01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ztr00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ztr00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ztr00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 274 aa AA seqDB search
MLLQSTCRRIALARPSTLASTMPLRAKILAPGSRQSSSAADIKELPGDEDNDVLFNTHGG
VRSITLNRPKKLNSLNGSMARKIVPRLREWSKSDLANVVIIKGEGRAFCAGGDVAWLAQR
NKTGTEGQQESKDYFGLEYKLDHLIATYRKPYVAFIDGITMGGGVGLSLHAPFRIATENT
VFAMPETNIGFFPDVGASFFLPRMDGELGTYCALTSEQIKGADVFFAGVATHYIHSSSLP
DLEARLSELNFKDYDSLQQRLQIINSTIEEFATG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcttctccaaagtacttgcaggagaatcgcactcgcgcgtccctccacattggcctcc
accatgcctctacgcgcaaagatcctcgctcccggctcaagacagtcttcgagcgcggcc
gatatcaaagaactccctggtgacgaagacaacgatgtcctcttcaatacccacggcggt
gtccggtccatcaccctcaaccgtccgaagaagctcaattccctcaacggcagcatggcc
cgcaagattgtacccagactacgagagtggagcaagagcgacctcgcgaacgttgtgatc
atcaaaggcgaaggacgagcattttgtgcgggaggagatgtagcttggctagcacaacgc
aacaagacgggtactgaaggacaacaagaaagtaaggactatttcggcctggaatacaaa
ctcgatcacctcattgcaacctatcgcaagccctacgtcgccttcatcgatggtatcacc
atgggcggcggtgtcggcctctccctccacgctccattccggatagccaccgagaacacc
gttttcgcgatgcccgagaccaacattggattcttccccgacgttggcgcctcgttcttc
ctcccacgtatggatggcgagttgggaacctactgcgccctcacctccgagcagatcaaa
ggcgccgacgttttctttgccggagtcgccacccactatatccactcctcctccctgccc
gacctcgaagcacgcctatcggaactcaacttcaaagactacgactccctccaacagcgc
ctccagatcatcaactccaccatcgaagaattcgccacgggc

DBGET integrated database retrieval system