KEGG   Zymoseptoria tritici: MYCGRDRAFT_103402Help
Entry
MYCGRDRAFT_103402 CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00280  Valine, leucine and isoleucine degradation
ztr00410  beta-Alanine metabolism
ztr00640  Propanoate metabolism
ztr01100  Metabolic pathways
ztr01200  Carbon metabolism
Module
ztr_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCGRDRAFT_103402
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCGRDRAFT_103402
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCGRDRAFT_103402
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     MYCGRDRAFT_103402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 13400056
NCBI-ProteinID: XP_003855369
JGI: Mycgr3_103402
UniProt: F9X1S6
Position
2
AA seq 274 aa AA seqDB search
MLLQSTCRRIALARPSTLASTMPLRAKILAPGSRQSSSAADIKELPGDEDNDVLFNTHGG
VRSITLNRPKKLNSLNGSMARKIVPRLREWSKSDLANVVIIKGEGRAFCAGGDVAWLAQR
NKTGTEGQQESKDYFGLEYKLDHLIATYRKPYVAFIDGITMGGGVGLSLHAPFRIATENT
VFAMPETNIGFFPDVGASFFLPRMDGELGTYCALTSEQIKGADVFFAGVATHYIHSSSLP
DLEARLSELNFKDYDSLQQRLQIINSTIEEFATG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcttctccaaagtacttgcaggagaatcgcactcgcgcgtccctccacattggcctcc
accatgcctctacgcgcaaagatcctcgctcccggctcaagacagtcttcgagcgcggcc
gatatcaaagaactccctggtgacgaagacaacgatgtcctcttcaatacccacggcggt
gtccggtccatcaccctcaaccgtccgaagaagctcaattccctcaacggcagcatggcc
cgcaagattgtacccagactacgagagtggagcaagagcgacctcgcgaacgttgtgatc
atcaaaggcgaaggacgagcattttgtgcgggaggagatgtagcttggctagcacaacgc
aacaagacgggtactgaaggacaacaagaaagtaaggactatttcggcctggaatacaaa
ctcgatcacctcattgcaacctatcgcaagccctacgtcgccttcatcgatggtatcacc
atgggcggcggtgtcggcctctccctccacgctccattccggatagccaccgagaacacc
gttttcgcgatgcccgagaccaacattggattcttccccgacgttggcgcctcgttcttc
ctcccacgtatggatggcgagttgggaacctactgcgccctcacctccgagcagatcaaa
ggcgccgacgttttctttgccggagtcgccacccactatatccactcctcctccctgccc
gacctcgaagcacgcctatcggaactcaacttcaaagactacgactccctccaacagcgc
ctccagatcatcaactccaccatcgaagaattcgccacgggc

DBGET integrated database retrieval system