KEGG   Zymoseptoria tritici: MYCGRDRAFT_103891Help
Entry
MYCGRDRAFT_103891 CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCGRDRAFT_103891
Enzymes [BR:ztr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYCGRDRAFT_103891
Transporters [BR:ztr02000]
 Other Transporters
  Pores ion channels [TC:1]
   MYCGRDRAFT_103891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_2 GST_N_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 13404362
NCBI-ProteinID: XP_003854259
JGI: Mycgr3_103891
UniProt: F9X5T1
Position
3
AA seq 267 aa AA seqDB search
MSDRPNGLIAKQGLELLTFGTPNGHKASIILEEIKEAYGKPDYVYQSINISQNIQKEKWF
TDVGPNGRIPVLVDHDAGGLGIQEGQAILSYVTRHFDPENKFSFKSDPELSLCEQWVAWQ
HGGLGPMQGQANHFYRLAKERIPYPTQRYVGETERLYGILDAQLASKEYLVGGKYSIADI
ANFSWVNVAYFAGVDLDQFPNLKKWWERINARPAVKKGVAIPNESTITNEAYQRRLKEED
GFKEKEDELKELGKKAKEQYDYKYSSP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccgaccgaacggcctcattgccaagcaaggcttggagctgctgacatttggc
actcccaatggccacaaagcgagcatcatccttgaggagatcaaagaggcttatggcaag
cccgactacgtctatcaatccatcaacatcagccagaacatccagaaggagaaatggttc
acagacgtcggtcccaatggacgtatcccagtcctcgtagatcatgatgcaggcggtctg
gggattcaggaggggcaagccattctgtcctatgtgacccgtcatttcgatcccgagaac
aagttctcattcaagagcgatcccgagctgtcgctttgcgagcagtgggttgcgtggcaa
cacggaggattgggtccgatgcagggacaggccaaccacttctaccgcctcgcaaaggaa
cgcattccctacccaacccaacgctacgtcggtgaaaccgagcgcctctacggcatcctc
gacgcccagctcgcctcgaaggagtacctcgtcggaggaaagtactccatagccgacatt
gccaacttcagctgggtgaacgtagcctacttcgcgggcgtggacctcgatcagttcccc
aacttgaagaagtggtgggagaggatcaatgctaggcctgcggtgaagaagggtgttgcg
attccgaacgagtcgacgatcacgaacgaggcgtatcagaggagactgaaggaggaggat
ggattcaaggagaaggaggatgagttgaaggagctgggcaagaaagcgaaggagcagtat
gattacaagtactcttctccttag

DBGET integrated database retrieval system