KEGG   Zymoseptoria tritici: MYCGRDRAFT_104970Help
Entry
MYCGRDRAFT_104970 CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00220  Arginine biosynthesis
ztr00330  Arginine and proline metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
ztr01230  Biosynthesis of amino acids
Module
ztr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MYCGRDRAFT_104970
   00330 Arginine and proline metabolism
    MYCGRDRAFT_104970
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MYCGRDRAFT_104970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 13401745
NCBI-ProteinID: XP_003851742
JGI: Mycgr3_104970
UniProt: F9XDZ8
Position
6
AA seq 230 aa AA seqDB search
MDASTIQTKFLDKPNELGLVAVGFSGGQCKPGTDAAPMALIEAGLVDQLRTDLEYNVFHD
NKVHAYTDLIPASDPDHRNMKKPRAVSAVTQQLSSQVYAHSREGRFVLTLGGDHSIAVGT
ISGTAKATRERLGRDIAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLARDEEDQPFGW
LRDEHRFSTTKLVYIGLRDVDRGEKKILRDNNIKAFSMHDIDRYGIGKVM
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggacgccagcaccatccaaaccaaattcctcgacaagcccaacgagctcggtctcgtt
gcggtgggcttctcaggcggacaatgcaaacccggcaccgacgccgcccccatggccctc
atcgaagccggcctcgtcgaccaactccgcaccgacctcgaatacaacgtcttccacgac
aacaaagtccatgcctacaccgacctcatcccagcctccgacccggaccaccgcaacatg
aagaaaccccgcgccgtctccgccgtgacccaacagctcagcagtcaagtctacgcccac
tcccgcgaaggccgcttcgtgctgaccctcggcggcgaccactccatcgccgtggggacc
atctcgggaaccgccaaggccacccgtgaacgtctggggcgggacattgcggtgatctgg
gtggacgcccacgcggatatcaatacgccggagacgagcgatagtgggaatattcatggg
atgccggtggcgttcttgacgggactggcgagggatgaggaggatcagccgtttgggtgg
ttgagggacgagcatcgcttcagcactacgaaactggtgtatatcggtttgagagatgtg
gatcgtggagagaagaagattcttcgagacaacaacatcaaagcgttttcgatgcacgat
atcgatcggtatggaatcgggaaggtgatg

DBGET integrated database retrieval system