KEGG   Zymoseptoria tritici: MYCGRDRAFT_105101Help
Entry
MYCGRDRAFT_105101 CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
Organism
ztr  Zymoseptoria tritici
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 243 aa AA seqDB search
MPYEPYTDETPADVKNAKGLHLVTQNTPNGQAVQIFLEELKDAYGTEFTTTVIDISTNEQ
KKDWFLRLDPNGRIPILIDNTQSPPFPVHETSAELFYLLKFADKSDKFGFSSPLERNQCL
QWTFFWHGSGAPYQGQVTHFTRAAPEKIPYAIDRFRNETLRVFGVLEIHLSGKYTGEEKE
YLAGNGKGRYSIADIKTYPWVKNWERSGFSKEEMAFPHLLKWVDRIAERPAVQRGVGEAY
VKK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgaaccatacacggacgagactccggccgacgtcaaaaatgccaaaggtctg
catctcgtcacgcagaatacccccaatggccaggccgttcagatcttcctcgaggaattg
aaggatgcctatggcaccgagttcactacgacagtcatcgacatctcgaccaacgagcaa
aagaaagactggttcctccgcctcgacccaaacggccgcattcccatcctgatcgacaac
acccaatccccaccctttcccgtccacgaaacctccgccgaactattctacctcctcaaa
ttcgccgacaaatccgacaaattcggcttctcctcccccctcgaacgcaaccaatgcctg
caatggacgtttttctggcacggctccggagccccctaccaaggccaagtcacacacttc
acccgcgccgcacccgagaaaatcccctacgccatcgaccgcttccgcaacgaaactctc
cgcgtcttcggcgtgctggaaatccatctgagtggaaagtacacgggagaagaaaaggag
tatctggcgggtaatggaaagggacgatattccattgctgacataaaaacctatccatgg
gtgaagaattgggagaggagtgggttttccaaggaggagatggcgtttccgcatttgtta
aagtgggtggatcggattgcggagaggccggccgtgcagaggggggttggggaggcgtat
gttaagaagtaa

DBGET integrated database retrieval system