KEGG   Zymoseptoria tritici: MYCGRDRAFT_105125Help
Entry
MYCGRDRAFT_105125 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ztr  Zymoseptoria tritici
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MYCGRDRAFT_105125
Translation factors [BR:ztr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MYCGRDRAFT_105125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 273 aa AA seqDB search
MAPPSAWDDEDSDSSASSSAPAVVVRRGKFDDEEDGGEVLDSWDAAEDSEVEREKAKKAA
EAKAKADALAKANAKSKSQRIEEKREERLRQKALEDLDGDSDEDEATKRARARDAELQGD
LQHAEDLFGGVGGVPASRGAKPITVQDSDDPANAIDLSGLSLFNPTTAQGFLKLRETLSP
LLNNNAKKPQYEMFMKEFSKQIVKEMNSEQIKKIASGLTALSNEKLKEEKAAEKGGKKTK
AAKTKTSLNANRNISASADTGAYDDGLDEDDFM
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggctccaccaagtgcttgggacgacgaggactctgacagctccgcgtcatcctccgct
cccgccgtcgtagtgcgtcgcggcaaattcgacgacgaagaagacggcggcgaggtgctc
gattcatgggacgcagcagaggacagcgaggtcgagcgcgagaaggcgaagaaagccgcg
gaggctaaagccaaagctgacgcgctcgcgaaagccaacgcgaagtccaagtcgcagagg
atagaagagaagcgagaagagcggctgcgacaaaaggctttggaggacttggacggagac
agcgatgaggatgaggccacgaagcgtgctcgtgcacgagacgccgagttgcaaggagac
ctccagcacgctgaggatctcttcggtggtgttggtggtgtgcctgcgagccgtggtgcc
aaacccatcaccgtgcaggacagcgacgatcctgcgaatgcgatcgatctctccggcctg
tctttgttcaaccctaccaccgcacagggtttcctcaagctgcgagagacgctgagcccg
cttctcaacaataacgcgaaaaagccgcaatacgagatgttcatgaaggagttctctaag
caaattgtgaaggagatgaacagcgagcagatcaagaaaattgccagtggtctgacggct
ctgagcaacgagaagctcaaggaggagaaggctgctgagaagggcgggaagaagaccaag
gccgcgaagaccaagaccagcttgaatgcgaaccgtaacatttccgcatcggccgatacc
ggtgcttacgacgatggtctcgatgaggatgacttcatgtga

DBGET integrated database retrieval system