KEGG   Zymoseptoria tritici: MYCGRDRAFT_106182Help
Entry
MYCGRDRAFT_106182 CDS       T02285                                 

Gene name
HTB2401
Definition
histone 2B
Orthology
K11252  
histone H2B
Organism
ztr  Zymoseptoria tritici
Brite
Exosome [BR:ztr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MYCGRDRAFT_106182 (HTB2401)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 138 aa AA seqDB search
MAPKAQKTPTTAGKAPAGKAPAEKKEAGKKTAAATGDKKKRTKTRKETYSSYIYKVLKQV
HPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAK
HAVSEGTKAVTKYSSSTK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaggcgcaaaagaccccaaccaccgccggcaaggcaccagctggcaaggct
cccgcagagaagaaggaggctggcaagaagaccgccgccgccactggtgacaagaagaag
cgcaccaagacccgcaaggagacctactcctcgtacatctacaaggtcctcaagcaggtc
caccctgacactggtatctccaaccgcgccatgtccatcctgaactccttcgtcaacgac
atcttcgagcgcgtcgcaaccgaggcatccaagctcgccgcatacaacaagaagtccacg
atctcctcgcgcgaaatccagacctccgtccgactcatcctccccggtgagctcgccaag
cacgccgtctctgagggcaccaaagccgtcaccaagtactcctcctccaccaaatag

DBGET integrated database retrieval system