KEGG   Zymoseptoria tritici: MYCGRDRAFT_107391Help
Entry
MYCGRDRAFT_107391 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ztr00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 664 aa AA seqDB search
MRNYSPCYLAVGGALLLPASARVLQPEEQLAALVARAFPANAPNGYTPQVRSCPSDISIR
PASDLSTNETEWLEKRRAATIDPMRDLLGRLNITGFDSNQYIDNNRGNTSALPNIGIAAS
GGGYRAMLNGAGLIQAFDSRTPNSTNAGQLGGLLQATTYLSGLSGGSWLVSSLYANNFTS
VDAIITADSDSDNLWQLQNSIFDGPDTGGIQLLDSLGYYKTLVDLVDDKENAGFNTTITD
YWGRALSYQLINATDGGPAYTFSSIAQQEFFTNGSVPLPLVVADSRAPGQKVVSTNSTVF
TFSPWELGSDDPSLYAFAPLQYVGTNFTDGSPRNNDECVVGYDNLGFVFGTSSSLFNAAL
TTLSGQNGNGAFSSLVVDALKGVLEKISSSEEDIADWVNPFFGYNNKTYKGSSDMMLTLV
DGGEDGQNIPLHPLIQPNRNVDVIFAIDSSADTNETWPTANSATGWPNGVSIVTTYERSL
SEIGNNTAFPAVPDINTFMNLGLNNKPTFFGCDAGNLTGPAPLVVYMPNSPYTYASNTST
FMLKYNMTKRDGLILNAYNGATQGNGTIDSEWPACVGCAILSRSFDRTGTTVPDACKQCF
QRYCWDGTVNSTAPGDYIPEFKVAGASTANSGGKNGAKKGAAGKLGVSVLAALGTAVVAG
MVVL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaggaactactctccttgttaccttgctgttggtggcgcattgctccttccggcatca
gccagagtgctgcagccggaagagcaattagctgccttggtcgctcgagcgttcccagcc
aacgctcccaatggctacacaccacaggttcggtcgtgcccaagcgacatttccattaga
cctgcctcggatctttcgacgaacgaaaccgaatggctggaaaagcgaagagcagccaca
atcgacccgatgcgagatctactcggacgactgaacataactgggttcgacagtaaccag
tatatcgacaacaatcgcggcaacacgagcgcgttgccgaacattggaatcgcagcgtca
ggaggtggatacagagctatgctgaatggagcaggtctcattcaggcattcgatagtcgt
actcccaatagcacaaacgctgggcagttgggaggtctgctgcaggcaacaacatatctt
tccggtctttctggtggcagttggctggtgagctcgctctacgccaacaatttcacgtct
gtggacgccatcatcactgccgacagtgacagtgacaatctctggcagcttcaaaactcc
atctttgacggtcccgatacgggcggcatacaactactggacagtctcggatactacaag
acgctcgtggacctagtggacgacaaggaaaacgctggattcaacacgactattacggac
tattggggaagggctttgagttatcaattgatcaacgcgaccgatggtggtccggcgtac
acgttttcgtctatcgctcagcaagagttcttcaccaacgggagtgtacctcttcccttg
gttgtcgccgacagccgtgcccctggtcagaaggtcgtgtctactaactcgaccgtcttt
acgttctctccttgggagcttggtagtgatgatccttccttgtatgccttcgcgcctctc
cagtacgtgggcacgaacttcaccgatggctcgccgcgaaacaacgacgagtgcgtggtg
ggctacgacaatcttggcttcgtgttcggaaccagctcgtcgctgttcaatgcggccctg
accacgctcagtggacagaacggtaacggagccttctccagcctcgttgtggacgcgctc
aaaggcgtccttgaaaagattagctcttctgaagaagacatcgccgactgggtgaatcct
ttcttcggctacaacaacaaaacatacaagggttccagcgacatgatgttgacgctcgtg
gatggtggtgaggacgggcagaacatcccgctgcatcctctcatccaacccaaccgaaat
gtcgatgttatcttcgcgattgattcttctgcggacacgaacgagacttggcccactgcc
aattcggccaccggctggcctaacggagtatcgatagtgaccacatacgagcgcagcctt
tcagagatcggaaataatactgcatttcccgcagtacccgacatcaacacattcatgaac
ctgggcctcaacaataaacccaccttcttcggttgcgatgcgggaaatcttactggccca
gcgccactggtcgtatacatgcctaactcaccatatacctacgcaagcaataccagcact
ttcatgctgaagtacaacatgactaaacgcgacggcctgatcttgaacgcctacaacggc
gcgacccaaggcaacgggacgattgatagcgagtggccagcctgtgttggatgtgcgatt
ttgagccgcagcttcgatcgcacgggcacaaccgttccggacgcttgcaagcagtgcttc
cagcgatactgctgggatggtacggtcaacagcaccgcgccgggcgattacatcccggaa
ttcaaggtcgctggggcctctactgctaacagtggtggaaagaatggtgctaagaagggt
gctgctggaaagctcggagtcagtgtactggcagccctgggtacggctgttgttgcgggt
atggtggttttgtga

DBGET integrated database retrieval system