KEGG   Zymoseptoria tritici: MYCGRDRAFT_108223Help
Entry
MYCGRDRAFT_108223 CDS       T02285                                 

Gene name
MgPMT2
Definition
Dolichyl-phosphate-mannose-protein mannosyltransferase 2 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ztr  Zymoseptoria tritici
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    MYCGRDRAFT_108223 (MgPMT2)
Enzymes [BR:ztr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     MYCGRDRAFT_108223 (MgPMT2)
Glycosyltransferases [BR:ztr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   MYCGRDRAFT_108223 (MgPMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 746 aa AA seqDB search
MAADGAITTGANTQGDLRKRNVAAGQNGNYVPQEPGNKLDEKSKEKVNTFLQTLDEWEWL
IAPLLFTILAFFTRLYKIGLSPIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLSG
YLAGYNGSFEFKSGEKYPENLDYTFMRQFNAFFGAVLIPLSYFTAKEMHFRKPVVWLITL
AVLCENSYCTISRFILLDSMLLCFTFTTVFTLFKFHNQRHQPFSLQWGFWLGMTGISIGC
VCSVKWVGMFGTALVGIYTIVDLWNKFGDLKMPKWELGAHVVFRVIGLIVIPLIVYMFTF
YLHFLILENSGPGDAQMSSLFQANLRGTEVGKDSPLEIAYGSKATLKNMGYGGGLLHSHV
QTYPEGSGQQQITCYHHKDANNDWFFYPNRHQPTYDPEADLKFVGNGDIIRLIHAQTGRN
LHSHTVPAPVTKADHEVSCYGNLTVGDTKDHWMVETVSDAASNDWTKLRTLTTSFRLKHV
DLNCYLRAGNVNLPQWGFKQIETTCVKANNPRDVYTHWNVESHVNERLPPSAPGAYKSPF
LRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLHVGLRMCGWDDAIVKYFLLGNP
VVYWGSTFSVFFIMAMIAYYAIRWQRGYDELTWKDLEQFHYSGIYPLLGWFLHYMPFVAM
ARVTYVHHYYPALYFAILTAGFIVDWYTRNLRSTSVKVAIFGVLYGLVIFMFWLFRAFCF
GMEGSNRQWAHLKWFDQWRMVDAPKA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgacggcgccatcacaacgggcgcaaacacccagggagatctcagaaaacga
aacgtcgcggctggtcagaatggcaactatgtcccacaagagcctgggaacaagctggat
gagaagagcaaggaaaaggtcaacacctttcttcagaccctcgacgaatgggagtggctg
atcgcgccgctcctcttcacgatcctcgccttcttcacgcgcttgtacaagatcggcctc
tcgcccattgtcacctgggatgaggcgcattttggaaagttcgggtctcactacctcaag
cgcgagttctactttgatgtgcaccctccgcttggaaaaatgctggtgggactttcagga
tacctcgcaggctacaatggctcgttcgagttcaagagcggagagaagtacccggagaac
ctcgattacaccttcatgcgccagttcaacgccttcttcggcgcggtcttgattcctctg
tcctacttcaccgcgaaagagatgcacttccggaagccagttgtctggctcatcacgttg
gcagtcctctgcgagaacagctactgcacgatcagcagattcatcctcctggacagcatg
ctcttgtgcttcaccttcaccacggtcttcaccttgttcaagtttcacaaccagaggcat
caaccgttctcgctccagtggggtttctggctcggcatgactggaatatccatcggatgc
gtgtgcagtgtgaagtgggtcggtatgtttggcaccgcgcttgtcggtatctacacgatc
gtggacctctggaacaagtttggcgaccttaagatgccaaagtgggagctgggagcgcat
gtggtctttcgcgttatcggcctgattgtcatcccgctcatcgtttacatgttcacattt
tacctccacttcctcatcttggagaactctggtcctggtgatgcgcaaatgtcatcgctc
ttccaggccaacctccgcggcactgaggttggaaaggacagcccattggagattgcgtat
ggttcgaaggctacgttgaagaacatgggatacggtggtggacttctacactctcacgtg
cagacctatcctgagggatctggccagcagcaaatcacttgctaccaccacaaagatgcc
aacaacgactggttcttctacccgaacagacaccagcctacctacgacccggaagcagat
ctcaagtttgtcggcaacggagacatcatccgattaatccacgctcagaccggccgcaac
ctccactctcacaccgtccccgctcccgtcaccaaggccgaccacgaggtctcttgctac
ggcaacttgactgttggtgacaccaaggaccactggatggtggagactgtcagtgatgcg
gcttccaacgattggacgaagcttcgcactttgaccacttctttccgtctgaagcacgtc
gatctcaactgctaccttcgtgctggcaatgtcaacctgccacagtggggtttcaagcag
attgagacgacttgtgtcaaagccaacaatcctcgcgatgtgtacactcactggaatgtt
gaatcccatgtgaacgagaggctgccacctagcgccccaggtgcttacaaatctccgttc
ctccgcgacttcattcacttgaatgtggccatgatgacctccaacaacgccctggttccc
gatcccgacaagcaggatgatctggcttccgcaccgtggcagtggcctctactccacgtc
ggtctacgcatgtgtggctgggacgatgccattgtcaagtacttcctcctcggcaatcca
gtggtttactggggctcgaccttctctgtattcttcatcatggccatgatcgcgtactac
gccattcgttggcagcgtggctacgacgagctcacctggaaggatctcgagcagttccac
tacagtggcatctaccctcttctcggctggttcctccactacatgccgtttgttgccatg
gctcgtgtcacctacgtgcatcactactatccagcgctgtacttcgccattctcaccgcc
ggattcatcgtcgactggtacactcgcaacttgcgcagcacctctgtcaaagtcgccatc
ttcggtgtgctatacggcttggtcatcttcatgttctggctgttccgcgccttctgcttc
ggcatggagggatcgaatagacaatgggcgcacctgaagtggtttgaccaatggaggatg
gtagatgctccaaaggcttag

DBGET integrated database retrieval system