KEGG   Zymoseptoria tritici: MYCGRDRAFT_108223Help
Entry
MYCGRDRAFT_108223 CDS       T02285                                 

Gene name
MgPMT2
Definition
Dolichyl-phosphate-mannose-protein mannosyltransferase 2 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ztr  Zymoseptoria tritici
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ztr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 746 aa AA seqDB search
MAADGAITTGANTQGDLRKRNVAAGQNGNYVPQEPGNKLDEKSKEKVNTFLQTLDEWEWL
IAPLLFTILAFFTRLYKIGLSPIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLSG
YLAGYNGSFEFKSGEKYPENLDYTFMRQFNAFFGAVLIPLSYFTAKEMHFRKPVVWLITL
AVLCENSYCTISRFILLDSMLLCFTFTTVFTLFKFHNQRHQPFSLQWGFWLGMTGISIGC
VCSVKWVGMFGTALVGIYTIVDLWNKFGDLKMPKWELGAHVVFRVIGLIVIPLIVYMFTF
YLHFLILENSGPGDAQMSSLFQANLRGTEVGKDSPLEIAYGSKATLKNMGYGGGLLHSHV
QTYPEGSGQQQITCYHHKDANNDWFFYPNRHQPTYDPEADLKFVGNGDIIRLIHAQTGRN
LHSHTVPAPVTKADHEVSCYGNLTVGDTKDHWMVETVSDAASNDWTKLRTLTTSFRLKHV
DLNCYLRAGNVNLPQWGFKQIETTCVKANNPRDVYTHWNVESHVNERLPPSAPGAYKSPF
LRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLHVGLRMCGWDDAIVKYFLLGNP
VVYWGSTFSVFFIMAMIAYYAIRWQRGYDELTWKDLEQFHYSGIYPLLGWFLHYMPFVAM
ARVTYVHHYYPALYFAILTAGFIVDWYTRNLRSTSVKVAIFGVLYGLVIFMFWLFRAFCF
GMEGSNRQWAHLKWFDQWRMVDAPKA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgacggcgccatcacaacgggcgcaaacacccagggagatctcagaaaacga
aacgtcgcggctggtcagaatggcaactatgtcccacaagagcctgggaacaagctggat
gagaagagcaaggaaaaggtcaacacctttcttcagaccctcgacgaatgggagtggctg
atcgcgccgctcctcttcacgatcctcgccttcttcacgcgcttgtacaagatcggcctc
tcgcccattgtcacctgggatgaggcgcattttggaaagttcgggtctcactacctcaag
cgcgagttctactttgatgtgcaccctccgcttggaaaaatgctggtgggactttcagga
tacctcgcaggctacaatggctcgttcgagttcaagagcggagagaagtacccggagaac
ctcgattacaccttcatgcgccagttcaacgccttcttcggcgcggtcttgattcctctg
tcctacttcaccgcgaaagagatgcacttccggaagccagttgtctggctcatcacgttg
gcagtcctctgcgagaacagctactgcacgatcagcagattcatcctcctggacagcatg
ctcttgtgcttcaccttcaccacggtcttcaccttgttcaagtttcacaaccagaggcat
caaccgttctcgctccagtggggtttctggctcggcatgactggaatatccatcggatgc
gtgtgcagtgtgaagtgggtcggtatgtttggcaccgcgcttgtcggtatctacacgatc
gtggacctctggaacaagtttggcgaccttaagatgccaaagtgggagctgggagcgcat
gtggtctttcgcgttatcggcctgattgtcatcccgctcatcgtttacatgttcacattt
tacctccacttcctcatcttggagaactctggtcctggtgatgcgcaaatgtcatcgctc
ttccaggccaacctccgcggcactgaggttggaaaggacagcccattggagattgcgtat
ggttcgaaggctacgttgaagaacatgggatacggtggtggacttctacactctcacgtg
cagacctatcctgagggatctggccagcagcaaatcacttgctaccaccacaaagatgcc
aacaacgactggttcttctacccgaacagacaccagcctacctacgacccggaagcagat
ctcaagtttgtcggcaacggagacatcatccgattaatccacgctcagaccggccgcaac
ctccactctcacaccgtccccgctcccgtcaccaaggccgaccacgaggtctcttgctac
ggcaacttgactgttggtgacaccaaggaccactggatggtggagactgtcagtgatgcg
gcttccaacgattggacgaagcttcgcactttgaccacttctttccgtctgaagcacgtc
gatctcaactgctaccttcgtgctggcaatgtcaacctgccacagtggggtttcaagcag
attgagacgacttgtgtcaaagccaacaatcctcgcgatgtgtacactcactggaatgtt
gaatcccatgtgaacgagaggctgccacctagcgccccaggtgcttacaaatctccgttc
ctccgcgacttcattcacttgaatgtggccatgatgacctccaacaacgccctggttccc
gatcccgacaagcaggatgatctggcttccgcaccgtggcagtggcctctactccacgtc
ggtctacgcatgtgtggctgggacgatgccattgtcaagtacttcctcctcggcaatcca
gtggtttactggggctcgaccttctctgtattcttcatcatggccatgatcgcgtactac
gccattcgttggcagcgtggctacgacgagctcacctggaaggatctcgagcagttccac
tacagtggcatctaccctcttctcggctggttcctccactacatgccgtttgttgccatg
gctcgtgtcacctacgtgcatcactactatccagcgctgtacttcgccattctcaccgcc
ggattcatcgtcgactggtacactcgcaacttgcgcagcacctctgtcaaagtcgccatc
ttcggtgtgctatacggcttggtcatcttcatgttctggctgttccgcgccttctgcttc
ggcatggagggatcgaatagacaatgggcgcacctgaagtggtttgaccaatggaggatg
gtagatgctccaaaggcttag

DBGET integrated database retrieval system