KEGG   Zymoseptoria tritici: MYCGRDRAFT_108567Help
Entry
MYCGRDRAFT_108567 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYCGRDRAFT_108567
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MYCGRDRAFT_108567
Exosome [BR:ztr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCGRDRAFT_108567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 596 aa AA seqDB search
MDMIQEERYEPDSSKDGPAVNNLHTISDTAPTDDMPGDRGRSGQRHARPRGAITWSKVTT
ATNMASSDMDFVGSIDQGTTSTRFLIFDRNGEPVAVHQEEFSQIYPSPGRHEHDPDEIIK
SVENCIAGAVKIFEDAGHSKDSIKSIGITNQRETTVVWDFSTGEALHNAIVWTDTRTAAL
ARELKGRSGSDKLQDICGLPISTYPSVTKLLWLLKNDDKVKKCYDAGNLAFGTIDSWLAY
KLNGGAEKKVFVSDPTNASRTMFMDIHTLKYSDTLLDFFSYEFDMRKIHLPEIVRSADKE
AYGKLSSGPLKGWPIQGCLGDQSAALVGQKGFEPGAAKNTYGTGCFLLYNVGDKPTISTH
GLLATVAYDFGKPVYALEGSIAVAGSGVKFLMNNLGFSHSSSKITELAETVKDNGGLVFV
TAFSGLFAPYWIDDAHGTMFGITHHTERGHIARATLEAVCFQTKAILDAMEKDSGHKLSE
LKVDGGMSNSELCMQTQADLVRIPIVRPKMRETTALGAAIAAGFAAGVWKDFEELKEVNT
KGETTFEPKMGDKEAGRMTRKWEKAVEMCRGWLEEEEAEAKEEIEEAEKERGKEKL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggacatgatccaggaagagcggtatgaaccagactcgagcaaggatggtccagctgtg
aacaatttgcacacaatctccgacacggcgccgaccgacgacatgcccggcgaccgcgga
aggagtggacagagacatgcccggccaagaggagcgatcacatggtccaaagtcacaaca
gcaacaaacatggcttcttcagacatggactttgttggcagcattgaccaaggcacgacc
agcactcgtttcctcatcttcgaccgaaacggcgagccagtcgcggtgcaccaagaagag
ttctctcagatctacccaagcccaggacgacacgagcacgacccggacgagattatcaag
tccgtcgagaactgcatcgccggtgctgtcaagatcttcgaggacgccggccactcgaaa
gacagcatcaaatcgatcggcatcacgaaccaacgcgaaacgaccgtggtatgggatttc
agcaccggagaagctttgcacaatgccatcgtatggaccgacactcgcacagcggcattg
gcgagagaactcaaaggacgctcgggaagtgacaagctgcaagacatctgcggtctgccc
atctcgacctacccatccgtcacaaaactcctctggctgttgaagaacgatgacaaagtc
aagaaatgctacgatgcaggaaatctggcattcggtacgatcgacagctggttggcatac
aagctgaacggaggagccgagaagaaagtgttcgtttcggacccgaccaatgcgagcagg
acgatgttcatggatattcacacgttgaagtacagcgacacactgctcgacttcttctct
tacgagtttgacatgaggaagatccacctgccggagatcgttcgctccgccgacaaggag
gcatatggaaagctgtcctctggtcctctgaaaggctggcctattcagggttgtttgggt
gatcagtccgccgccctggtcgggcagaaaggcttcgagccaggtgcggcaaagaacaca
tacggtactggatgtttcctgctttacaatgttggtgacaagccgaccatttccacgcat
ggtctgctcgcgaccgtagcatacgatttcggcaagccagtgtatgctctcgaaggcagt
atcgcagtggcgggatcaggagtcaagttcttgatgaacaaccttggattcagccattct
tcctcgaaaatcacggagctggcagagacagtcaaggacaacggcggcttggtcttcgtc
acagcattcagcggtctcttcgcaccctactggattgacgacgctcacggcacaatgttc
ggcataacccaccacaccgaacgcggccacatcgcccgcgccaccctcgaagccgtctgc
ttccaaaccaaagccatcctcgacgccatggagaaagattccggccacaaactctccgaa
ctcaaagtcgatggcggcatgtccaactcggaactctgcatgcaaacccaggcggacctg
gtgcgcatcccgatcgtgcggccaaagatgcgcgagacgaccgcgctaggagcggcgatt
gcggcgggctttgcggcgggcgtgtggaaggactttgaggagttgaaggaggtgaatacc
aagggcgagacgacgttcgagccgaagatgggagataaggaggcgggacgaatgacgagg
aagtgggagaaggcggtggagatgtgtaggggttggttggaggaagaggaggcggaggcg
aaggaggagattgaggaagcggagaaggagagggggaaggagaagttgtag

DBGET integrated database retrieval system