KEGG   Zymoseptoria tritici: MYCGRDRAFT_108743Help
Entry
MYCGRDRAFT_108743 CDS       T02285                                 

Gene name
HAM2401
Definition
histone acetyltransferase, MYST family
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCGRDRAFT_108743 (HAM2401)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1095 aa AA seqDB search
MAVEEDDDAPVAEELDEEELDAPGEPDDEAEVDDEGTDADAEGDEDDDEGEFVGAVKTRS
ARSRARRIPEDEESVVEEPDRDADSDESSQAEEEDWEAADDLEEDQKIANADANRCVFCQ
QTEDNDPSEDYEEYLACSVCGDNAHRQCARTAGSLASDEDAAHWRCSECVENGLEEDFKD
VPHMLSTRRGSSAPKMARDLLPAVRGGIKPGSHSVFNTLILPDDEMDGSRSLRKRKTPSE
DIDEPPRAAIRKRARTSPIDDHEPHDFKQIENAEEDADDAGASALGGDENAQLDEVDALD
GPSSPKSRSGRPQRNQKSRRHGAWIVSMSDEPKSAIISIAVTVAQWDQIQRDVEKKRKRR
ERDRQRRIRNTRVTVTAEPEENTTHFPTVQTTMYTNPFFPFQDREMDESKAKPYGGILTD
AEADTTRTYPQDADRQAFQNAREKAEQEWKERVAQTNGETPARSKQAGQPSKIKCINFGQ
YEIDTWHAAPYPEEYSRNKHLYICEFCLKYMSSDYVAWRHKLKCSAKHPPGDEIYRDHVT
NSETGAETTLSFFEVDGRRNPLYCQNLCLLAKLFLGSKTLYYDVEPFLFYIMTENDEFGC
HFVGYFSKEKRGCGSAPLLDPRTSFDDSNNPQADGGADADLEGTAADPALSNPGNNVSCI
LVLPVHMRRGFGRVLIEFSYLLTKVEKRTGSPEKPLSDMGLVSYRSYWRTVLCKLLLRYK
GREATASDPAPPLSIVDIAKETGMTPDDIIATLEALRFLVRDPITRSYALRLDYDYMKEY
VEKAEKKATIKIDPARLCWTPYVMGRPTNLFAMGEETNQPLQTVAPRDDPAEDMQSLKAN
VQGKVPKETAQKTEQSVVATETIELAPPLLPNGKSNSPSPKSRKKTPPPALDLTQKANAM
AASPDRTAGSPGRRSPRKTPNGSKHAPPHAHSFPNSAAASPASFQTISASGSGSQPDSAG
HIPPTRFEVFPPVPGMPTAKRRPGRPVGRRSSGRNNYNTPARRSHASRSQRDGGATSPSS
RAGRDRGGRERGGSLRRTRSTLADVAFTASAVAEEDDADKLEVAVEDEEREKDAIMEDDE
DEDAPGEEDDEIQYE
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggaggaggacgatgacgcacctgtggccgaggaattggacgaggaagagcta
gatgcgccgggcgaaccggatgatgaggctgaggtcgatgatgaaggcacagacgcagat
gcggaaggagacgaggatgacgatgagggcgaattcgttggtgctgtgaagacgagatct
gccagatcgagggcccgcaggatcccagaggacgaggaatccgttgtcgaagaaccagac
cgagacgcagattccgatgagagcagtcaagccgaagaagaggactgggaggccgctgac
gatctggaggaggatcaaaagattgcgaatgcagatgccaatcgctgcgtcttctgccaa
cagactgaggacaacgatccaagcgaggattatgaggaatatctggcatgttcggtttgt
ggtgacaatgcccatcggcaatgtgccagaaccgcaggctcgctagcttccgacgaagat
gccgcccactggcgctgctccgaatgtgtcgaaaatggactcgaagaggatttcaaagat
gtgcctcatatgttgtcgacccgtcggggatcgtcggcaccgaagatggcgcgagatctg
ttgccagccgtccgtggtggtatcaagcctggctcgcattctgtgttcaacaccttgatc
ctgccagacgacgagatggatggatcgaggtcgcttagaaagcgcaagaccccttcagaa
gacatcgatgagccgcctcgagctgccattcggaagcgtgcgaggacgagtccgatagac
gaccacgagccacatgatttcaagcaaatcgagaacgcagaagaagacgctgatgatgca
ggagcttctgcccttggcggtgacgaaaatgcccaacttgacgaggtcgatgcgttggac
ggaccaagctcgcccaagtcgcgttccgggcgaccacaacgaaatcaaaagagccgcaga
cacggcgcctggattgtgtccatgtcggatgaaccgaagtctgccattatcagcattgct
gtgactgttgcgcaatgggaccagatccagcgcgatgtcgaaaagaaacggaagcgtcgc
gaacgcgatcgacaaagaagaattcggaacactcgcgtaactgtgactgcggagccagag
gagaatactacccactttccaacagtacaaacaaccatgtacactaatccattcttcccc
ttccaagatcgcgaaatggatgagtcgaaagcgaagccatatggtggcatactcaccgac
gcggaagccgacacaacacgaacgtacccacaggacgccgaccgacaagcatttcaaaat
gcgcgtgaaaaagcggagcaggaatggaaagagcgggtcgcgcagacgaatggcgaaacg
ccggcgcggtcgaagcaggctggtcaaccaagcaagatcaaatgcatcaactttggccag
tacgaaatcgatacatggcatgctgcgccatacccagaggaatacagccgcaacaaacac
ctctacatatgcgagttctgtctgaagtacatgagctcggactatgttgcctggcgtcac
aagctgaagtgctcagctaagcaccctccgggagacgaaatctatcgcgaccatgttacg
aactcggagacaggcgccgaaaccacactgtcattcttcgaggtagacggtcggagaaat
cctctctactgccagaacctctgtctgctggcaaagttgttcttgggatcaaaaacgctt
tattacgatgtcgaaccgttcctcttctacatcatgactgagaacgatgagttcggttgt
cattttgttggctatttctcaaaagagaagcgaggctgcgggtctgcgcctcttttggac
cctcgcacatccttcgatgacagcaacaatcctcaagcagatggcggagctgatgctgac
ctggagggtacagcggcagatccggctctcagtaatcctggaaacaacgtttcctgcatc
ctggtccttcctgttcacatgcggcgaggcttcggcagagtcttgatcgagttctcatac
cttctgacgaaagtcgagaagcgtactggctcgcccgagaagcctctctcggacatgggt
ctggtgtcatatcgatcctactggcgcacagtcctttgcaagctcttgctgcgctacaag
ggcagggaggccacggcaagtgatccagcacctccactttcgattgtggacatcgccaag
gagacaggaatgactccagacgacatcatcgccacgctcgaagccctccgtttcttggtg
cgcgatccaatcacccgttcttatgctttgcgcctcgactacgactacatgaaagagtac
gtcgagaaggcggagaagaaggctaccatcaagattgatcccgcgcgcttgtgttggacg
ccgtacgttatgggtcggccgacgaatcttttcgcaatgggcgaggagacgaatcagcct
cttcagaccgtcgctcctcgagacgatcctgctgaagatatgcaatctctaaaagcaaac
gtgcaggggaaagtgccgaaagagacggcgcagaagaccgagcagagtgtggtcgctacc
gagacaattgagctggccccgccactcctacccaatggcaagagcaatagtccttcgcca
aagtctcgtaagaagactccacctccagctcttgatttgacgcaaaaggcaaacgcaatg
gccgcctccccagatcgcacagctggctctccaggccgccgctcacctcggaagacgccc
aacggctcgaaacatgcgccgccccacgcgcactcctttcccaactccgccgccgcgagc
cctgcgtcattccaaaccatctccgccagcgggtccggatcccaacctgactctgctggc
cacattccacctacccggttcgaggtctttcctcctgttcccggcatgcccaccgccaaa
cgccgacctggtcgcccggtgggcagacgcagcagcggtcgcaacaactacaatactccc
gcgagacgtagtcatgctagtcgtagccagagggacggcggtgctactagtcctagcagc
cgtgccggaagagaccgtggaggccgggaacggggaggcagtctacgacgtacacgaagc
actctagctgacgttgcattcaccgcttctgctgtggcggaggaagatgatgccgataag
ttggaggttgctgtcgaggatgaagagcgagagaaggacgcgataatggaagatgacgaa
gatgaagacgcgcccggcgaggaggatgacgagatccagtatgagtga

DBGET integrated database retrieval system