KEGG   Zymoseptoria tritici: MYCGRDRAFT_110138Help
Entry
MYCGRDRAFT_110138 CDS       T02285                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
ztr  Zymoseptoria tritici
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MYCGRDRAFT_110138
Exosome [BR:ztr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MYCGRDRAFT_110138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 1700 aa AA seqDB search
MAPLPIKFTELLQLTSVGVLQPSIGFNSCTLESDHYVCIRQKVDDNAQPEVLIVNLKNGN
SVMKRPIKADSAIMHWSKEIIALKAGGKTLQIFDLAQKSKIKSTTMSEDVVFWKWFDDSS
LGLVTESSVYHWNIFDPSEVSPRKMFERNQNLSGCQIINYRVADDEKWMVVVGISQQQGR
VVGSMQLYSKERGISQAIEGHAAAFGTYRMEDAPADTKLFTFANRSATGAKLHIVEVDHQ
APNPVFQKKAVDIYFPAEATNDFPVAMQVSSKYKVIYLVTKYGFIHLYDLETGTTIFMNR
ISSDTIFTTAGDEDGTGIVGVNRKGQVLAVSVDESTIIPYLLQNPENAELAYKLASRAGL
PGADQLYQQRFDQLLNSGDYQQAAKTAANSPQGFLRTPATIEKFKNVPQQQGQLSVILQY
FGMLLDKGKLNQHETLELARPVLSQNRKHLLEKWMKEGKLGCSEQLGDLVRLHDVALAQQ
IYQEAGASQKVIAAMAESGNFEQILPYSRSAGYTPDFNALLQHIVRVNPEKGAEFATALA
KEDASLIDVDRTVDIFQAQGMVQQATAFLLDVLSANKPEQGHLQTRLLEMNLVNAPQVAD
AILGNEMFSHYDKPRIAQLCENAGLLTRALEHYEDPASIKRCIVQSDKIPEEFLINYFGR
LTVDLALECLDEMLKVNIRQNLQAVINISKKFSDLFGPTRIIDLLEKYRTAEGLYFYLGG
IVNLSEDNEVTFKYIEAATTMGQLQEVERICRESNHYDPEKVKNFLKEAKLTEQLPLIIV
CDRFNFVHDLVLYLYKNQQFKSIEVYVQRVNPARTPGVIGGLLDVDCDESIIKNLLQSVS
PESIPIDELVSEVESRNRLKLLLPFLEQTLAAGNQQVAVYNALAKIYIDSNNDPEKFLKE
NDMYDTLIVGKYCEKRDPNLACIAYTKGQNDLELISITNENAMFRAQARYLITRADSEIW
SYVLSENNIHRRSLVDQVISTAVPESQDPEKVSIAVKAFIDADMPVELIELLEKIILEPS
TFSDNANLQNLLMLTAAKSDRGRVANYIQQLDQYSPDDIAQQCIEVGMYEEAFLIHKKAE
NHTEAANVLVDHVVSIDRAQEYAEQVDLPEVWSKVAKAQLDGLRVTDSVESYIRAQDPAN
HLEVIETATHAGKDDDLIKYLRMARKTLREPAVDTALAFAYARTNQLPELEDFLRASNVA
NIEESGDKAYAEGLHEAAKIFFSSINNWAKLATTLVHLEDYQAAVDCARKANSVKVWKQV
NQACVDKKEFRLAQICGLNLIVHAEELDDLVKQYERNGYFDELISLLEAGLGLERAHMGV
FTSLAIVLSKYHPEQVMDHLRIFWGRINIPKVIKAVEDAHLWRELVFLHTHYDEFDNAAL
AMMERAADAWEHQTFKETIVKVANLEIYYKSLNFYLQEQPSLITDLLQALTPRIDVNRVV
KMFEKSDNIPLIKPFLLNVQGQNKRAVNDAINDLLIEEEDHKQLRDSVQNFDNYEAVALA
QRLEKHDLVFFRQIAANIYRKNKRWDKSIQLSKQDKLYKDAIETAAMSGKTEVVEELLRY
FVDIGSKECYTSMLYACYDLIPLHTVMEISWRHNLTDFTMPFMINFMSQQAATISELKRD
NDERKAREASEKKEEDTGPILGQSRLMLTQGPIGQQPNGVMAQPTGMYACVLQYQDFGST
LQVLVHSMFMSLAAAGVNSP
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgctaccgatcaagttcacggagctgctgcaactcacatccgtgggagttctg
caaccttcaataggcttcaactcgtgtaccctcgaatccgatcactacgtttgcatacgg
cagaaagtcgacgacaatgcccagccggaagttctcatcgtcaacctcaagaatggaaac
agcgtcatgaagcggccgatcaaggccgacagcgccatcatgcattggagcaaggagatt
attgccctgaaggcgggtggaaagacactgcagatttttgatttggcacaaaagagcaag
atcaagagcaccacaatgtccgaggatgtggtcttctggaagtggttcgacgacagctct
cttggccttgtcacggaatccagtgtctaccactggaacatcttcgatccatccgaagtc
tcgcctcggaagatgttcgaacgcaatcagaatctgtcaggatgtcagatcatcaactat
cgcgttgcggacgacgagaagtggatggtcgtggttggcatttcgcaacagcagggacgt
gtcgttggtagcatgcagctatactcgaaagagcgtggtatcagtcaagccattgagggt
catgcggctgcatttggaacatacagaatggaggatgcgccagcggacaccaagctcttc
accttcgccaaccgttcagcgactggcgcgaagctacacatcgttgaggttgatcaccaa
gcgccgaatccagtcttccagaagaaggctgtcgacatctacttcccagcagaggcaacg
aacgatttcccggtcgccatgcaagtctcgtcgaagtacaaggtcatctacttggtgacc
aagtacggcttcatccacctttacgatctcgagaccggcacgaccatctttatgaaccgc
atttcgagcgatacgattttcacgacggccggtgatgaggatgggacaggaattgttggc
gtgaaccgcaagggtcaagttctggctgtcagcgtggatgagagcacgatcattccatac
ttgttgcaaaacccagagaatgcggagctggcctacaagttggcatcaagagcgggactt
cccggcgcggatcaactataccagcaacgattcgatcagctgttgaactccggcgactac
cagcaagctgcaaagactgctgccaactctccacaagggttcctccgcacacctgcaacc
attgagaagttcaagaatgtacctcagcagcaaggccagctttcggtcatcctgcaatac
tttggcatgctcctcgataagggcaagctgaaccagcacgagactcttgagcttgctcga
cccgtgctttcccagaaccgcaagcatctgcttgagaagtggatgaaggagggcaagctt
ggatgctcggagcagcttggtgatctcgttcgcctgcacgatgtcgcgctcgcgcaacag
atctatcaggaggctggcgcatcacagaaggtcattgctgccatggcagagtcaggcaac
ttcgaacagattttgccatactctcgctctgctggctacacccctgacttcaacgccctc
cttcagcacattgtgcgggtcaacccagagaagggtgccgaattcgccacagctcttgct
aaagaggacgccagcctgatcgatgttgatcgtaccgtggacatcttccaagcacagggt
atggttcagcaagcaacggcattccttttggacgtcctttcggccaacaagcccgagcaa
ggccacttgcagacacgactactagagatgaacttggtcaatgcgcctcaagtcgcggac
gctatcctcggcaatgagatgttctcacactacgacaagccgcgcattgcccagctttgt
gagaatgcaggccttctgacccgagctctggaacactacgaggatcccgccagcatcaag
agatgtattgtccaatccgacaagattccggaagagttcctcatcaactactttggtcgc
ttgaccgtggacctcgcactagagtgcctcgacgagatgctcaaggtcaatatccgccag
aaccttcaagccgtcattaacatcagcaaaaagttctctgacctcttcggaccgactcgc
atcatcgacttgctcgagaagtaccgcacagcagagggcttgtacttctacctgggcggc
attgtcaacttgagcgaagacaacgaggtcaccttcaagtacatcgaggctgcaacgaca
atggggcagcttcaagaagtcgagcgtatctgtcgcgagagcaaccactacgatcctgaa
aaggtgaagaatttcttgaaggaggccaagctgaccgagcagttgcctctgatcatcgtt
tgcgatcgattcaacttcgtccacgatcttgtgctatacctgtacaagaaccaacagttc
aagtcgattgaggtctacgttcagcgagtcaatccagctcgtacacccggtgtcattggc
ggtcttttggacgttgactgtgatgagagcatcatcaagaacctgctgcaatccgtctcg
ccagaatcgatacccatcgacgagcttgtgtctgaggtggaatcccgcaatcgtttgaag
cttctcctcccatttttggagcagactttggcggctggcaaccaacaagtcgctgtctac
aatgccctggccaagatctacatcgactcgaacaacgacccggagaagttcctcaaggag
aacgacatgtatgacacgctgatcgttggaaagtactgtgagaagcgtgatcccaacctc
gcctgcatcgcctacaccaaaggccagaacgatcttgaactcatcagcatcacaaacgag
aacgccatgttcagagcgcaagcacgatacctcatcactcgcgctgactctgagatctgg
tcttacgtcctgtctgagaacaacatccaccgcagatcactcgtggatcaggtcatctcc
accgctgtgcccgagagccaggatcctgagaaggtgtccatcgcggtcaaggctttcatt
gatgccgacatgcccgtggaactgattgagctgctcgagaagatcattttggagccatcg
accttcagcgacaacgccaacttgcagaacttgctgatgctcactgccgccaagtctgat
cgcggtcgtgttgccaactacatccagcagcttgaccagtacagccctgatgatattgcc
cagcaatgtatcgaggtcggcatgtacgaggaggcattcctcattcacaagaaggccgag
aaccacaccgaggcggccaacgtcttggttgaccatgtagtgtctattgacagggctcag
gaatacgcagaacaggtcgaccttccggaagtctggagtaaggtggctaaggctcagctt
gatggactacgagtcaccgactctgtcgaatcgtacatccgcgcacaagaccctgccaac
catctcgaggtcatcgagactgccacccacgcaggaaaggatgacgacctcataaagtac
ctccgcatggcgcgcaagactcttcgtgaaccagccgtcgacaccgcacttgctttcgcc
tacgctcgcacgaaccagcttcccgagctggaggacttcctccgtgcctcgaatgtcgcc
aacatcgaggagtcgggtgacaaggcgtacgctgagggtctgcacgaggctgcgaagatc
ttcttctcgtcaatcaacaactgggccaagctcgccacgactctcgtgcacttggaggac
taccaagccgctgtcgactgcgcccgcaaggccaacagcgtcaaggtttggaagcaggtc
aaccaggcatgtgtggacaagaaggagttccgacttgcacaaatttgtggtttgaacctc
atcgtccacgccgaagaattggatgatctggtcaagcagtacgagcgaaatggatacttt
gacgaactcatcagcctgctcgaagccggccttggtctcgagagagcgcacatgggggtc
tttacctctttggctatcgtgctcagcaagtatcaccccgaacaagtgatggaccattta
cggatcttctgggggcgcatcaacattcccaaggtcatcaaggccgtcgaagatgcgcac
ctctggcgagagctcgtgttcctgcatacccactacgacgaattcgacaacgctgccctg
gcgatgatggagagagctgcagatgcctgggagcaccagaccttcaaggagacgatcgtc
aaagtggctaacctcgaaatctactataaatcgttgaacttctacctccaggaacagccg
tcgctcatcaccgatcttctccaggctctcactccccggatcgatgtcaatcgcgttgtc
aagatgttcgagaaatcagacaatattcctctcatcaagcctttcctgctcaacgtccaa
ggccagaacaagcgcgcagtcaacgacgctatcaacgacctgctcattgaggaggaagac
cacaagcagctccgcgacagcgttcagaacttcgacaactacgaggctgtcgcccttgcc
cagcgattagagaagcacgatcttgtcttcttccgacagatcgctgccaacatctaccgc
aagaacaagcgatgggacaaatcgatccagctctcgaagcaggacaagctttacaaggat
gccatcgagaccgccgccatgtcgggcaagaccgaggtcgtcgaggagctccttcgctac
ttcgtcgatatcggcagcaaagaatgctacacatccatgctttacgcctgctacgacctc
atcccactccacaccgtcatggagatctcatggcggcacaatctcaccgacttcactatg
ccgttcatgatcaacttcatgtcgcagcaagccgccaccatcagcgagctcaagcgcgac
aacgacgagcgcaaagctcgcgaggcgtcggagaagaaggaagaggacacgggtcctatt
ctcggacagtcgagattgatgttgacacagggtccgattggacagcagcctaatggtgtg
atggcgcagccgacgggaatgtatgcatgtgtgttgcagtatcaagatttcggatcgact
ttgcaagtactggtccactcaatgttcatgtcgctcgccgcggctggcgtgaactctcct
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system