KEGG   Zymoseptoria tritici: MYCGRDRAFT_110289Help
Entry
MYCGRDRAFT_110289 CDS       T02285                                 

Gene name
GHY
Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ztr  Zymoseptoria tritici
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MYCGRDRAFT_110289 (GHY)
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYCGRDRAFT_110289 (GHY)
   00600 Sphingolipid metabolism
    MYCGRDRAFT_110289 (GHY)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    MYCGRDRAFT_110289 (GHY)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MYCGRDRAFT_110289 (GHY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 812 aa AA seqDB search
MWPTTTATTFVAGAVLVGGVLGQSAINAQGTNFTLTADNASYLFHVDPETLDLTSDHFGG
PSTDFVTPGWISTQGWLDGLSIKRREFPNIGSSDVRLPAIHIQHSNGTTVTEFRYQSHRI
VEGKPDLPGLPATYGEAGDVSTLIVQLYDNVSDIGAALSYSVFPAYNAIARSFQITNNGS
GEIIIERAASFSLDLPNLDLEMLELHGDWSHEGNRIKRKVDFGETGFRSSLGYSSHLYNP
FFALMSPSTTETTGEAWGFNLIYTGSFAATVERISSGLVRVLLGMNPLHSSLHVQPGESW
TSPEAVGVYSSTGLGGMSRSFHDLYRNHLSRAKQTNQTRPVLLNSWEGLGFGINDTAMVT
LAGEAADLGIELLVMDDGWFGVEYPRNNDTLGLGDWTPNPAKFPVGLNPFITEITSNITV
ANASSSSSSMRFGLWVEPEMISPNSTLYHEHPDWALHSGSYTRSLTRSQLVLNVGLPEVQ
EFIITSVSRILNSAPISYVKWDNNRGMHELPTPSAEHTYMLGLYNILNNLTTTFPDVLFE
GCASGGGRFDPGILHYWPQSWTSDNTDASDRLTIQLGMSVVYPPSAMGCHISAVPNGLTH
RNISIEYRADVALMCGSFGFELNPDELSAEETAAIPGIMEQWRQLNPLVIAGDFYRLAIP
QESNWPAVQFVSKDKSESAVFMYQQQAKIKPSPPPVRLVGLDAGARYTNDWDNATYTGAT
YMSQGLSPRWKTEDYQSKVVWGSILRFVSAVPVIKPYTTLSYRRPSRVFVQNLTNLRLNG
SLSMAGENRSAINDARRRSFTVPGPPSSSSGF
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgtggcctacgacgactgcgacgacgtttgtggcgggtgcggtactggtgggtggcgtg
ctgggacagagtgccatcaacgcccaaggcaccaacttcaccctcacagctgacaacgct
tcctacctcttccacgtcgacccggagactctggacctcacttcggaccactttggcggt
ccctccactgacttcgtcactcccggctggatctctactcagggttggctggacggcctc
agcatcaagcgaagagaattccccaacatcggcagcagcgacgtgcggctaccggccatc
cacattcaacactccaacggaaccacagtcaccgagtttcgctaccaatcacaccggatc
gttgagggaaagccagaccttccaggtcttcccgcaacatacggcgaagcaggcgatgtc
tccaccttgatcgttcaactctacgacaacgtctcggacattggagcagctctctcctac
tccgtctttcctgcctacaacgccatcgcacgtagcttccagataaccaataatggctcc
ggcgagatcatcatcgagcgtgcggccagcttcagtctggatctgccgaacttggatctt
gaaatgctcgagcttcatggagattggtcccatgagggcaatcgcatcaagcgaaaggtg
gactttggcgagactggattccggagctccctgggatactcctctcatctgtacaaccca
ttcttcgctctgatgtcgccctccactaccgagacgaccggagaagcctggggattcaat
ctcatctacaccggctcctttgccgccaccgttgagcgcatttccagtggcctcgtgcgt
gtccttctcggaatgaatcctctccacagcagccttcacgtacagcccggtgaaagctgg
acctcaccggaagcagtcggcgtttactcctccacaggcctcggaggcatgtcccgtagc
tttcacgatctgtaccgcaaccacctctcccgcgcgaagcaaactaaccagactcgcccg
gtcctcctcaactcttgggagggtctcggcttcggcataaacgacaccgccatggtgact
ctcgccggtgaggctgccgatctcggcatcgaactcctcgtcatggacgacggatggttt
ggcgtggaatatcctcgcaacaacgacaccctcggcctaggcgactggactcccaacccg
gcaaaattccctgtcggcctcaaccctttcatcaccgaaatcacctccaacatcacagtc
gccaacgcctcctcctcttcctcctccatgcgttttggtctctgggtcgaaccggaaatg
atctcacccaactccactctctaccacgaacatcccgactgggccctgcactccggctct
tatactcgctctctcactcgctcccaactcgtcctgaacgtcggcctccccgaagtccaa
gagttcattatcacgtccgtctcccgcatcctcaattccgcaccgatctcctacgtcaaa
tgggacaacaaccgcggcatgcacgagctcccaaccccatccgccgagcatacctacatg
ctcggcctgtacaacatcctcaataatctcaccaccacattcccagacgtcctcttcgaa
ggctgcgcctccggtggcggtcgtttcgaccctggtatcctccactactggccgcaatcg
tggacgtccgacaacaccgacgcttccgaccgcctcaccatccagctgggcatgtcagtc
gtctatccgccttcggccatgggttgtcacatctccgcagtaccaaatggtcttacccac
cgcaacatctccatcgagtatcgcgcggatgtcgcactcatgtgtggatccttcggtttc
gagctgaatccagatgaactctccgctgaagagacagccgccatcccaggcatcatggag
caatggcgtcaactcaatcctctcgtcatcgcaggtgacttttaccgcctcgccatcccg
caggaatcgaactggccggcggttcaattcgtcagcaaggacaagtccgagtcggcggtg
ttcatgtaccaacaacaagcgaaaattaagccgtctccgccaccggtcagattggtggga
ctagatgctggggcgaggtacacgaatgactgggacaatgcgacgtatactggtgcgacg
tacatgagccagggactgagtccgaggtggaagacggaggattatcagagtaaagttgtt
tggggatccattctccgcttcgtgagcgctgtcccggtgatcaagccttatactacgcta
tcgtaccggcgaccgtcccgtgtcttcgtccaaaacctgaccaacttgaggctcaacgga
tcactttccatggctggtgaaaaccggtccgccatcaacgacgctcgccgaagatccttc
acagtgccaggcccgccttcttcgtccagcggcttctga

DBGET integrated database retrieval system