KEGG   Zymoseptoria tritici: MYCGRDRAFT_110289Help
Entry
MYCGRDRAFT_110289 CDS       T02285                                 

Gene name
GHY
Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ztr  Zymoseptoria tritici
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ztr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ztr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ztr00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ztr00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 812 aa AA seqDB search
MWPTTTATTFVAGAVLVGGVLGQSAINAQGTNFTLTADNASYLFHVDPETLDLTSDHFGG
PSTDFVTPGWISTQGWLDGLSIKRREFPNIGSSDVRLPAIHIQHSNGTTVTEFRYQSHRI
VEGKPDLPGLPATYGEAGDVSTLIVQLYDNVSDIGAALSYSVFPAYNAIARSFQITNNGS
GEIIIERAASFSLDLPNLDLEMLELHGDWSHEGNRIKRKVDFGETGFRSSLGYSSHLYNP
FFALMSPSTTETTGEAWGFNLIYTGSFAATVERISSGLVRVLLGMNPLHSSLHVQPGESW
TSPEAVGVYSSTGLGGMSRSFHDLYRNHLSRAKQTNQTRPVLLNSWEGLGFGINDTAMVT
LAGEAADLGIELLVMDDGWFGVEYPRNNDTLGLGDWTPNPAKFPVGLNPFITEITSNITV
ANASSSSSSMRFGLWVEPEMISPNSTLYHEHPDWALHSGSYTRSLTRSQLVLNVGLPEVQ
EFIITSVSRILNSAPISYVKWDNNRGMHELPTPSAEHTYMLGLYNILNNLTTTFPDVLFE
GCASGGGRFDPGILHYWPQSWTSDNTDASDRLTIQLGMSVVYPPSAMGCHISAVPNGLTH
RNISIEYRADVALMCGSFGFELNPDELSAEETAAIPGIMEQWRQLNPLVIAGDFYRLAIP
QESNWPAVQFVSKDKSESAVFMYQQQAKIKPSPPPVRLVGLDAGARYTNDWDNATYTGAT
YMSQGLSPRWKTEDYQSKVVWGSILRFVSAVPVIKPYTTLSYRRPSRVFVQNLTNLRLNG
SLSMAGENRSAINDARRRSFTVPGPPSSSSGF
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgtggcctacgacgactgcgacgacgtttgtggcgggtgcggtactggtgggtggcgtg
ctgggacagagtgccatcaacgcccaaggcaccaacttcaccctcacagctgacaacgct
tcctacctcttccacgtcgacccggagactctggacctcacttcggaccactttggcggt
ccctccactgacttcgtcactcccggctggatctctactcagggttggctggacggcctc
agcatcaagcgaagagaattccccaacatcggcagcagcgacgtgcggctaccggccatc
cacattcaacactccaacggaaccacagtcaccgagtttcgctaccaatcacaccggatc
gttgagggaaagccagaccttccaggtcttcccgcaacatacggcgaagcaggcgatgtc
tccaccttgatcgttcaactctacgacaacgtctcggacattggagcagctctctcctac
tccgtctttcctgcctacaacgccatcgcacgtagcttccagataaccaataatggctcc
ggcgagatcatcatcgagcgtgcggccagcttcagtctggatctgccgaacttggatctt
gaaatgctcgagcttcatggagattggtcccatgagggcaatcgcatcaagcgaaaggtg
gactttggcgagactggattccggagctccctgggatactcctctcatctgtacaaccca
ttcttcgctctgatgtcgccctccactaccgagacgaccggagaagcctggggattcaat
ctcatctacaccggctcctttgccgccaccgttgagcgcatttccagtggcctcgtgcgt
gtccttctcggaatgaatcctctccacagcagccttcacgtacagcccggtgaaagctgg
acctcaccggaagcagtcggcgtttactcctccacaggcctcggaggcatgtcccgtagc
tttcacgatctgtaccgcaaccacctctcccgcgcgaagcaaactaaccagactcgcccg
gtcctcctcaactcttgggagggtctcggcttcggcataaacgacaccgccatggtgact
ctcgccggtgaggctgccgatctcggcatcgaactcctcgtcatggacgacggatggttt
ggcgtggaatatcctcgcaacaacgacaccctcggcctaggcgactggactcccaacccg
gcaaaattccctgtcggcctcaaccctttcatcaccgaaatcacctccaacatcacagtc
gccaacgcctcctcctcttcctcctccatgcgttttggtctctgggtcgaaccggaaatg
atctcacccaactccactctctaccacgaacatcccgactgggccctgcactccggctct
tatactcgctctctcactcgctcccaactcgtcctgaacgtcggcctccccgaagtccaa
gagttcattatcacgtccgtctcccgcatcctcaattccgcaccgatctcctacgtcaaa
tgggacaacaaccgcggcatgcacgagctcccaaccccatccgccgagcatacctacatg
ctcggcctgtacaacatcctcaataatctcaccaccacattcccagacgtcctcttcgaa
ggctgcgcctccggtggcggtcgtttcgaccctggtatcctccactactggccgcaatcg
tggacgtccgacaacaccgacgcttccgaccgcctcaccatccagctgggcatgtcagtc
gtctatccgccttcggccatgggttgtcacatctccgcagtaccaaatggtcttacccac
cgcaacatctccatcgagtatcgcgcggatgtcgcactcatgtgtggatccttcggtttc
gagctgaatccagatgaactctccgctgaagagacagccgccatcccaggcatcatggag
caatggcgtcaactcaatcctctcgtcatcgcaggtgacttttaccgcctcgccatcccg
caggaatcgaactggccggcggttcaattcgtcagcaaggacaagtccgagtcggcggtg
ttcatgtaccaacaacaagcgaaaattaagccgtctccgccaccggtcagattggtggga
ctagatgctggggcgaggtacacgaatgactgggacaatgcgacgtatactggtgcgacg
tacatgagccagggactgagtccgaggtggaagacggaggattatcagagtaaagttgtt
tggggatccattctccgcttcgtgagcgctgtcccggtgatcaagccttatactacgcta
tcgtaccggcgaccgtcccgtgtcttcgtccaaaacctgaccaacttgaggctcaacgga
tcactttccatggctggtgaaaaccggtccgccatcaacgacgctcgccgaagatccttc
acagtgccaggcccgccttcttcgtccagcggcttctga

DBGET integrated database retrieval system