KEGG   Zymoseptoria tritici: MYCGRDRAFT_110410Help
Entry
MYCGRDRAFT_110410 CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
ztr  Zymoseptoria tritici
Pathway
ztr03022  Basal transcription factors
ztr03420  Nucleotide excision repair
Module
ztr_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MYCGRDRAFT_110410
  Replication and repair
   03420 Nucleotide excision repair
    MYCGRDRAFT_110410
Transcription machinery [BR:ztr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     MYCGRDRAFT_110410
DNA repair and recombination proteins [BR:ztr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     MYCGRDRAFT_110410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N His_kinase TFIIB DUF2992
Motif
Other DBs
NCBI-GeneID: 13395006
NCBI-ProteinID: XP_003849994
JGI: Mycgr3_110410
UniProt: F9XH99
Position
8
AA seq 363 aa AA seqDB search
MPSATKHNLTEDDIYRTSTQYRFWSFSPEQLSARRKETHRLALQRAAQYTQNDASTEHLT
LEEELRLVTRYAELLRTTSDHLKWPANIKSTAIQYLRRFYLSNSCMTYPPKEIYKTVLFL
ASKTEAFHITLSKFCSMISADPEAVLAPEYKVMQALRFTLDVRQPFRGLKGVLMELINLV
DEERDGLKDLKPPEGGATSWKPPPGGKMEKKHMNDRVQAAYAAARNMLDAPASLTDAYFL
YTPSQILLASLLLADEPLYECYLGTKLTLDSPTRPKILGTIQDCAQLMSSYDSKASMTKE
ERAELEKKLEACRDPSTKDMVKNHAAMKLNADDDDSDAKRKKAEKQQKTRAADDMFGPSL
GKG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccttcggccacgaagcacaaccttaccgaggacgacatatatcgcacatcaacgcag
tatcgcttctggtcattctctcccgagcaattgtccgcacgccgcaaagaaacccaccga
ctcgccctccaacgagcagcacaatacactcaaaacgatgcatccaccgaacatctcacc
ctcgaagaggaacttcgcctcgtaacccgatatgccgaactcctccgcactacctccgac
cacctgaaatggcccgccaacatcaagtcaaccgccatccaatacctcagacgattctac
ttgagcaattcgtgcatgacatatcctccgaaagaaatatacaagacagtgctctttctc
gcgagcaaaactgaggccttccatatcacactgagcaaattctgctccatgatcagtgcg
gatccagaggctgttctggcgccagagtacaaagtgatgcaagcgctgcgattcacactg
gacgtacggcagccatttcggggactgaagggagtgctgatggagttgatcaacctggtg
gatgaggaaagagatggtctgaaggatctcaaacccccagaaggcggagcgacgtcgtgg
aagccgcctccaggaggcaagatggagaagaaacacatgaacgatcgtgtgcaagccgca
tatgctgctgcacgcaatatgctcgatgcacctgcatcgctcacggacgcatactttctc
tacacgcctagccagattttgctggcgtctctgttgctcgcagacgagccattgtacgaa
tgctacctgggcacgaaactgacattggattcacctacacggccgaagattcttggaact
attcaggactgtgcacagctcatgtcaagctacgattcaaaagcaagtatgacgaaggag
gagcgcgcggagttggagaagaagctggaagcatgtcgggaccccagtaccaaagacatg
gttaagaatcatgcggctatgaagctgaatgccgatgatgatgacagcgatgcgaagcgg
aaaaaggccgagaagcagcagaagacgagagcggcagacgatatgttcggtccgagtctg
ggcaaggggtga

DBGET integrated database retrieval system