KEGG   Zymoseptoria tritici: MYCGRDRAFT_110410Help
Entry
MYCGRDRAFT_110410 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
ztr  Zymoseptoria tritici
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ztr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ztr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 363 aa AA seqDB search
MPSATKHNLTEDDIYRTSTQYRFWSFSPEQLSARRKETHRLALQRAAQYTQNDASTEHLT
LEEELRLVTRYAELLRTTSDHLKWPANIKSTAIQYLRRFYLSNSCMTYPPKEIYKTVLFL
ASKTEAFHITLSKFCSMISADPEAVLAPEYKVMQALRFTLDVRQPFRGLKGVLMELINLV
DEERDGLKDLKPPEGGATSWKPPPGGKMEKKHMNDRVQAAYAAARNMLDAPASLTDAYFL
YTPSQILLASLLLADEPLYECYLGTKLTLDSPTRPKILGTIQDCAQLMSSYDSKASMTKE
ERAELEKKLEACRDPSTKDMVKNHAAMKLNADDDDSDAKRKKAEKQQKTRAADDMFGPSL
GKG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccttcggccacgaagcacaaccttaccgaggacgacatatatcgcacatcaacgcag
tatcgcttctggtcattctctcccgagcaattgtccgcacgccgcaaagaaacccaccga
ctcgccctccaacgagcagcacaatacactcaaaacgatgcatccaccgaacatctcacc
ctcgaagaggaacttcgcctcgtaacccgatatgccgaactcctccgcactacctccgac
cacctgaaatggcccgccaacatcaagtcaaccgccatccaatacctcagacgattctac
ttgagcaattcgtgcatgacatatcctccgaaagaaatatacaagacagtgctctttctc
gcgagcaaaactgaggccttccatatcacactgagcaaattctgctccatgatcagtgcg
gatccagaggctgttctggcgccagagtacaaagtgatgcaagcgctgcgattcacactg
gacgtacggcagccatttcggggactgaagggagtgctgatggagttgatcaacctggtg
gatgaggaaagagatggtctgaaggatctcaaacccccagaaggcggagcgacgtcgtgg
aagccgcctccaggaggcaagatggagaagaaacacatgaacgatcgtgtgcaagccgca
tatgctgctgcacgcaatatgctcgatgcacctgcatcgctcacggacgcatactttctc
tacacgcctagccagattttgctggcgtctctgttgctcgcagacgagccattgtacgaa
tgctacctgggcacgaaactgacattggattcacctacacggccgaagattcttggaact
attcaggactgtgcacagctcatgtcaagctacgattcaaaagcaagtatgacgaaggag
gagcgcgcggagttggagaagaagctggaagcatgtcgggaccccagtaccaaagacatg
gttaagaatcatgcggctatgaagctgaatgccgatgatgatgacagcgatgcgaagcgg
aaaaaggccgagaagcagcagaagacgagagcggcagacgatatgttcggtccgagtctg
ggcaaggggtga

DBGET integrated database retrieval system