KEGG   Zymoseptoria tritici: MYCGRDRAFT_110597Help
Entry
MYCGRDRAFT_110597 CDS       T02285                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCGRDRAFT_110597
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MYCGRDRAFT_110597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 650 aa AA seqDB search
MASNTLLSAAQWAGATSSLLLRLSAFIFLRWPFPPIVYSLFAVYIPSFYYAFTHTSPFNI
ISDRVYVTEQDTSPQDLQDVDPRYVDEPGMDAGKELVVEEEIEVEEKDAHAILTLLTGLP
SPTSLVWSAITFFINAALVAMVVDLVWRAHFFHPAHDLSMARVGYVSHDTANILVREPDI
SQLPIFASYRSAETPSHLDDSWKSAGSVSDLSNLTDFTSTFKLTKLKPDTRYEYTISTDH
FGTFTTPPRPGQISDRPEKSNTFTFLHSSCIKPNFPYTPFSHPLSIRGLKHLSALLPTLS
AQFMLFLGDFIYIDVPHRKGSTPFHYRQEYRQVYASPDWPAATQNLPWLHVYDDHEIAND
WDQSTSAPFPAANDPYALYHTSVNPPPHRPGGDNSYFSFIQGPASFFLADTRRYRTPSSP
SSNSTLLGEPQLTDLLAWLAAPTPPGVRWKFFITSVPFTRNWRFGTEDTWGGYLSERRRI
LEAMWDVGEKGGVGVVILSGDRHEFAATSFPPPPGGKWGQEARVVEFSVSPLSMFYLPVR
TYSETPLSFLPSFLSSKSGSPMSSTGVEGEDDYETDICLKYLPDGNSKFSAVSLEAPGPD
GAGREGEGQAVLRYRLFVEGKETWRYTLTTPEGGQGHVKGRGRAWDAVWG
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacactctcctcagtgccgcccagtgggctggcgcaacgagctccttgctg
cttcgactgtccgccttcatatttctccgatggcccttcccaccgatcgtatactccctc
tttgctgtctacatcccgtctttctactacgctttcacccatacttcgcctttcaacatc
atctcagatcgagtctacgtgaccgaacaggatacctcgcctcaagacctacaagatgtt
gatcctcgatacgtcgatgagccgggcatggatgcaggcaaagagctggtcgtggaggag
gagatcgaagtagaagagaaggatgcacacgctattttgactctactcacgggtctgccg
agtccaacgagtctggtttggagtgccataacgttcttcatcaacgcagcactcgtggcc
atggtcgttgacctggtctggagggcacacttcttccatcccgcccatgacctttccatg
gcacgagtaggctacgtctcccacgataccgccaatattctcgtccgcgagccggacata
tctcaactgcctatcttcgcgtcataccgatcagccgaaacgccatctcatttggacgat
tcgtggaaatctgctggcagtgtttccgacctctctaacctcacagacttcacctctacc
ttcaagctcaccaagctcaaacccgacactcgctatgagtataccatttcgaccgaccac
tttgggacattcaccactccacctcgtccaggtcagatctctgatcgtcctgagaagtcg
aataccttcacgttcctccactcctcgtgcatcaaacccaactttccatatacgccattc
tcccatcctctctcgatccgcggtctcaaacacctttccgcactacttccaactctatcc
gcccagttcatgctcttccttggtgactttatctacatcgacgtgccccaccgcaaaggc
tcaactcccttccactaccgacaagaataccgacaagtgtacgcctccccggactggccc
gctgccacacaaaacctcccttggctacacgtctacgatgaccacgaaatcgccaacgac
tgggatcagtccacctctgccccatttcccgccgccaatgatccctacgccctgtaccac
acctccgtcaacccaccacctcaccgccccggcggtgataactcctacttctccttcatc
caaggtcccgcgtccttcttcctggccgacacccgccgctaccgtactccatcctctccc
tctagcaactccaccctcctcggcgaaccccaactcactgacctcctcgcctggctcgct
gccccaaccccacccggcgttcgctggaaatttttcatcacctccgtgcccttcacccgc
aactggcgcttcggcacagaagatacatggggcgggtatctctccgaacgccgccgaatc
ctcgaagcgatgtgggatgtcggcgagaagggaggcgtgggcgttgttattttgtcgggc
gatagacatgaattcgcagccacatcgttcccgcctccgccaggaggaaagtggggtcag
gaagcgagagtggtggagtttagtgtgagtccgttgagtatgttctacttgcccgtgaga
acatattcggagacgccgctgtccttcctgccttccttcttgagctctaaatctggctcg
ccaatgtcgtcgaccggagtggaaggagaagacgactacgaaacagatatttgtctcaag
tacctcccagatggaaacagcaaattctccgctgtgagtctggaagctcctggcccggat
ggtgcgggcagagaaggcgagggccaggctgtgttgcggtatcgattgttcgtggagggg
aaggagacgtggcggtacactcttacgacgccggagggtggacagggacatgtgaaaggg
agggggagggcttgggatgctgtgtggggatga

DBGET integrated database retrieval system