KEGG   Zymoseptoria tritici: MYCGRDRAFT_111309Help
Entry
MYCGRDRAFT_111309 CDS       T02285                                 

Gene name
KGD2
Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ztr  Zymoseptoria tritici
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCGRDRAFT_111309 (KGD2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCGRDRAFT_111309 (KGD2)
  Amino acid metabolism
   00310 Lysine degradation
    MYCGRDRAFT_111309 (KGD2)
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MYCGRDRAFT_111309 (KGD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 472 aa AA seqDB search
MSSAQCLRRLAIRPVLRAASCTAPRASAGLRTLSTGISYSKALPALSESSKSLQPLQARH
FSLTSRYHEEQIVKVPTMAESISEGTLKQFSKQVGDYVELDEEIATIETDKIDVAVNAPA
AGTIKEFLANEEDTVTVGQDLVKLELGGEPGQKAEKAGSEPKDAASSDQKTSSQTEGETE
KSKSEPKEESKPAPKQESKPEPKQESKPAPPKQEQKPKKEESKPKESESKSESPYGNREE
RRIKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSALMNLRKKYKDEVLKKTGVKFGFMS
AFSRAAVLAMKEVPTVNASIEGPGGGDTIVYKDYVDISVAVATEKGLVTPVVRNAESMDM
IGIEKSIAELGKKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIN
QKPVAIDGKVEIRPMMYLALTYDHRLLDGREAVTFLVKIKEYIEDPSRMLLF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgctcagtgccttcgccgactggcgatccgccctgttcttcgcgctgcatct
tgcactgctccacgagcttccgctggccttcgcaccctctccactggcatctcctactcg
aaagctcttcccgcgctctcagaatcatcaaagtctctccaaccactgcaagctcgccat
ttcagtttaacaagtcgataccatgaggagcagatcgttaaagtcccaacgatggccgaa
tcgatatccgagggtacattgaagcaattctcaaaacaggtcggcgactacgttgagctg
gacgaggagatagccaccatcgagaccgacaagatcgacgtcgctgtcaatgcacctgct
gctggtaccatcaaggagtttcttgcgaatgaggaggacactgttactgtgggacaagat
ttggtgaagctcgagctgggcggagagccaggacaaaaagcggagaaggcaggtagcgag
ccaaaggatgcggcatcatcagaccagaagacctcttctcagacagagggcgagacagaa
aagtccaaatcggagcccaaggaggaatcaaagcctgcgccaaagcaagaatcaaagcct
gagcccaagcaggagtcaaagccagcacctcccaagcaggagcagaagccaaagaaggag
gagtcaaaacccaaggagtcggaatcaaagtccgaatcgccctacggcaaccgtgaggag
cgccgcatcaagatgaaccgcatgcgcctacgaatcgccgagcgcctgaagcagtcgcag
aacaccgccgcttcgctcacgaccttcaacgaggtggacatgtccgcgcttatgaacctg
cgaaagaagtacaaggatgaagtcctcaagaagacgggcgtcaagttcggcttcatgagc
gctttctcacgcgcggctgtcctcgccatgaaggaggttcccaccgtcaacgccagcatc
gagggcccaggcggtggcgacaccattgtctacaaggactacgtcgacatcagcgttgcg
gtcgccacggagaagggtctcgtcacccccgtcgtgcgcaacgccgagagcatggacatg
atcggaattgagaagtccatcgccgagctcggcaagaaggcccgcgacaacaaacttacc
atcgaagacatggccggcggcaccttcactatctccaacggcggcgtcttcggctccctc
atgggcacgcccatcatcaacctgccacaaaccgccgttctgggcctccacgccatcaac
cagaaacccgtcgccatcgacggcaaagtcgagattcgtccgatgatgtacctcgctttg
acgtacgatcacagattattggatggacgggaggcggtgacgtttttggtgaagattaag
gagtatattgaggatccgagtcggatgttgctgttctag

DBGET integrated database retrieval system