KEGG   Zymoseptoria tritici: MYCGRDRAFT_111499Help
Entry
MYCGRDRAFT_111499 CDS       T02285                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ztr  Zymoseptoria tritici
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ztr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 356 aa AA seqDB search
MAFSSANSAANPTQGDLKGDVEVANPPTDSVSALRFSPAADYLSVSSWDNNVRIYEVKEN
GTTEGKAMFSHEGPALNTCWSGDGTKVFGVGADKAARMLDLGGDITKPTQVAAHDEPIRC
VESFQANGTPMLVTGSWDKTVKYWDLRQQTPVASLDVKERVYTMDVRNDQMLVVGTAERW
IHVIDLKNPTTFFKSMQSPLKWQTRVVSTFADGTGFAVGSIEGRCAIQYIEDKDAGSNFS
FKCHRQTPPNDRTISNVFAVNAISFHPQHGTFSTAGSDGTFHFWDKDAKHRLKGYPEVGG
TISATAFNRTGSIFAYAVSYDWSKGYQFNTQQTPNKIMLHPIVGDECKPRPKTTKR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctttctcgagcgccaacagcgcggcaaaccctacccagggcgacctcaaaggcgac
gtcgaggttgcgaaccctcccaccgacagcgtttctgccctgcgcttcagccctgccgct
gactacctatccgtatcgagttgggacaacaatgtgaggatatacgaggtcaaagagaat
ggaacgacggaaggaaaggcaatgttcagtcatgagggccccgcgttgaacacatgttgg
agtggggacggtacaaaagtcttcggagttggcgcggacaaagctgcgcgaatgcttgat
ctcggaggcgacatcacgaaacctacacaagtcgctgcgcatgacgagccaattcgctgc
gtagagtcctttcaggccaacggcactcccatgctggtgacaggcagctgggacaagacg
gtgaagtactgggacttgcgacaacaaacgcccgtcgcctcattggacgtcaaggagcgc
gtctacaccatggatgtccgtaacgaccagatgctcgtggtcggcacggcagaacgatgg
attcacgtgatcgacctcaagaaccccacaaccttcttcaaatcaatgcaatcacctctc
aaatggcagacccgagttgtcagcactttcgctgacggtaccggcttcgccgtcggcagc
atagaaggccgctgcgcgattcaatacatcgaagacaaggatgcgggcagcaacttcagc
ttcaagtgccatcgacaaacaccaccgaacgaccgcaccatcagcaacgtcttcgccgtc
aacgccatcagcttccatccccaacacggcactttcagcaccgcgggatctgacggcacg
ttccacttctgggacaaggacgcaaagcacaggctgaagggctatcctgaggttggtggc
accatcagcgcaacggcgttcaatcgcactggcagcatcttcgcctacgcggtcagctac
gactggagcaagggctaccagttcaacacccagcagacacccaacaagatcatgcttcat
ccgattgtgggggatgagtgcaagcctcgcccgaagacaacgaagcggtag

DBGET integrated database retrieval system