KEGG   Zymoseptoria tritici: MYCGRDRAFT_15930Help
Entry
MYCGRDRAFT_15930  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ztr  Zymoseptoria tritici
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYCGRDRAFT_15930
  Lipid metabolism
   00062 Fatty acid elongation
    MYCGRDRAFT_15930
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     MYCGRDRAFT_15930
Lipid biosynthesis proteins [BR:ztr01004]
 Fatty acid synthase
  Component type
   MYCGRDRAFT_15930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 295 aa AA seqDB search
PLPLLIWHGLGDTHDAEGLHSVGSLAESIHPQTYTYYIRIDDDSGEDRKATFFGNLTAQV
EKVCGDIQADPKLLDPTTGTIRVDALGFSQGGQFLRGLVQTCEGLSVRSLVTFGSQHNGI
AELKACGTWDLLCKGALALARGNIWSAYVQSHVIPAQYFRSVNDTTGLGSEEYLSSSGWL
ARMNNELEVKNSTYKQRISELENFVMFIFEEDTTVIPKESGWFAEVNGTDGKVTELRERR
MFKEDWLGLRELDEKGGLVFETTEGEHMQLDEEVLRRTFGRYFGPERRVGRASVE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
cccctccccctcctcatctggcacggcctaggagatacccacgacgccgaaggtctgcac
tccgtcggctccctcgccgagtcgatacacccacaaacctacacctattacatccgcatc
gacgacgacagcggggaagacaggaaagcgactttcttcggcaacttgacggcgcaagtg
gagaaagtatgcggcgacatccaggctgatccgaaactgctggatcctacgacgggcacg
atacgggtggatgcgttggggttctcacaaggaggacagttcttgaggggcttggtgcag
acgtgtgagggactaagtgtgaggagcttggtcacatttgggagtcaacataatggcatc
gcggaattgaaagcgtgtgggacgtgggatttactgtgtaaaggcgcactggcgttggcg
aggggaaacatttggagtgcatatgtccaatcgcacgtcattcccgcgcaatacttccgc
tccgttaacgacacgacgggactcggcagtgaggaatacctctcctccagcggctggctc
gcaaggatgaacaacgagcttgaggtcaaaaattcgacctacaagcagcgaatcagcgaa
ctggagaatttcgtcatgttcattttcgaggaggatacaacggtgattccaaaggagagt
ggatggttcgcggaggttaatggcacggatgggaaggttacggagttgagggagaggaga
atgttcaaggaggattggttggggttgagggaactggatgagaagggtgggttggtgttt
gagacgacggagggggagcatatgcagttggatgaggaggttttgaggaggacttttggg
aggtattttgggccggagaggagggtgggaagggcttccgtggaa

DBGET integrated database retrieval system