KEGG   Zymoseptoria tritici: MYCGRDRAFT_15930Help
Entry
MYCGRDRAFT_15930  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ztr  Zymoseptoria tritici
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ztr01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ztr00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 295 aa AA seqDB search
PLPLLIWHGLGDTHDAEGLHSVGSLAESIHPQTYTYYIRIDDDSGEDRKATFFGNLTAQV
EKVCGDIQADPKLLDPTTGTIRVDALGFSQGGQFLRGLVQTCEGLSVRSLVTFGSQHNGI
AELKACGTWDLLCKGALALARGNIWSAYVQSHVIPAQYFRSVNDTTGLGSEEYLSSSGWL
ARMNNELEVKNSTYKQRISELENFVMFIFEEDTTVIPKESGWFAEVNGTDGKVTELRERR
MFKEDWLGLRELDEKGGLVFETTEGEHMQLDEEVLRRTFGRYFGPERRVGRASVE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
cccctccccctcctcatctggcacggcctaggagatacccacgacgccgaaggtctgcac
tccgtcggctccctcgccgagtcgatacacccacaaacctacacctattacatccgcatc
gacgacgacagcggggaagacaggaaagcgactttcttcggcaacttgacggcgcaagtg
gagaaagtatgcggcgacatccaggctgatccgaaactgctggatcctacgacgggcacg
atacgggtggatgcgttggggttctcacaaggaggacagttcttgaggggcttggtgcag
acgtgtgagggactaagtgtgaggagcttggtcacatttgggagtcaacataatggcatc
gcggaattgaaagcgtgtgggacgtgggatttactgtgtaaaggcgcactggcgttggcg
aggggaaacatttggagtgcatatgtccaatcgcacgtcattcccgcgcaatacttccgc
tccgttaacgacacgacgggactcggcagtgaggaatacctctcctccagcggctggctc
gcaaggatgaacaacgagcttgaggtcaaaaattcgacctacaagcagcgaatcagcgaa
ctggagaatttcgtcatgttcattttcgaggaggatacaacggtgattccaaaggagagt
ggatggttcgcggaggttaatggcacggatgggaaggttacggagttgagggagaggaga
atgttcaaggaggattggttggggttgagggaactggatgagaagggtgggttggtgttt
gagacgacggagggggagcatatgcagttggatgaggaggttttgaggaggacttttggg
aggtattttgggccggagaggagggtgggaagggcttccgtggaa

DBGET integrated database retrieval system