KEGG   Zymoseptoria tritici: MYCGRDRAFT_21049Help
Entry
MYCGRDRAFT_21049  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ztr  Zymoseptoria tritici
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:ztr04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ztr04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ztr04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 770 aa AA seqDB search
ASQMRQLIYYHLDNDMLDNANFIAGRLHALEPRNPENSHLLALTYFRLRRFKAAYDFSQK
YGANGRHLGCAYIFAQACLALGRNMDGVTALEKCRSAWAGKNHWNQHSETSRRHMPDASA
ALTLLAKLWRAHGDSGKAGDLFIEVHKQNPFVWDAFEGLCKIGADLKTENMFRPVMELPG
LTETGNGETQIYVDEDSRQPRVLQAKSGSYVSMDDPFTSTVVEELDSLDHRLLGKSVLGL
PLKPTSTEWDTPTANGGVLDDDTAMGGISAENDDTFFEPPAAPNRRSRMGHHPEVTDRPR
PHGLRNQSASEGLSDDPLAAPRKATAGGQKRNISGTAAQSSLDSTQPRRSNRLFTQTTAP
NRSTRSTMDTAASIAGRADRVARQAKPATGARGRTGAVVGRVVSGNTKRLPPDEKEKRTN
GRTNEKNATLARSEQQDAMASLLNNFRHLAVGCHAIASFDMPTAITTFRGLPAAQRETPW
VLAQLGKAYYEAGNFRPAEDCFARLMKIQPSRIEDMDMYSTVLWHLKKDTTLTYLCRVLQ
DHDSDAPQTWVAVGNAFSLSREHDQAISAFKRATQVDPNFAYAYTLMGHEYIANEAFDNA
LASFRHSVSVDRRGYGGWYGLGKVFQCMGKLDDAERHFRIAASINPSNATLLVCIGVVLE
RLRNKKGALANFTRALELDPTSALARFKKARVLMHLKEYEQALGELEVLRDQAPDEANVW
FLLGKCYKGLSERGEALRAFTTALNLDVKAAPFIKEAMEALDEEDEESDD
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
gcctcgcagatgcgacagctgatctactaccacctcgataacgacatgctcgacaacgcc
aacttcattgctggtcgccttcatgcactcgaaccacgaaatcccgaaaattcgcatctc
ctcgccctcacctactttcgcctccgccgattcaaggccgcctacgatttcagtcaaaag
tacggcgctaatggtcggcatcttggatgtgcgtatatctttgcacaggcgtgcttggca
ttggggaggaacatggatggtgtgacggcgttggagaaatgccgatctgcttgggcaggg
aagaatcattggaatcaacactcggagacatcgaggcgtcacatgcctgatgcatcggca
gcgcttacacttctggcgaagctgtggcgtgctcatggcgattctggtaaggcgggagac
ctgttcatcgaagtacacaagcaaaacccgttcgtgtgggacgcatttgagggactgtgc
aaaatcggggcggatttgaagacggagaacatgttcaggccggtcatggagttacctggg
ctgacggagacgggcaatggtgagacacagatttacgttgatgaagattcacggcaaccg
cgagtgctgcaggcaaaatccgggtcgtatgtctcgatggacgacccattcacttctacg
gtggttgaggagctggattcgctggaccacaggttgctcgggaagtctgtcctgggacta
cccctgaaaccaacatcgacggaatgggacactcctacagcaaatggcggagtgttggac
gacgatacggcaatgggaggcatttctgccgagaacgatgatacattcttcgagcctccg
gccgcaccaaatcggagatcacgaatgggccatcaccccgaggtcacagaccggccgcga
ccgcatgggcttcggaaccaatctgcatctgaaggactgtcagacgatcctctggcggcg
ccgcgcaaagcgaccgcaggcgggcagaagcggaacatttctggaacggccgcacaatct
tctttggactctacgcaacctcgaagaagcaaccggctcttcactcagacaacagcgccg
aatcgaagcactcgctcaaccatggacacggcagcatcaatagcaggcagggctgataga
gtcgctcgtcaagcaaagccagctaccggcgctcgaggtcggacaggtgctgtcgtcggc
agggtcgtcagtgggaatactaagagacttccacctgatgagaaggagaagcgcacgaac
ggtcgaacaaatgagaaaaacgccaccctcgctagatccgaacagcaggacgccatggcc
tcattgttgaacaacttccgccatcttgccgtcggttgccatgcgattgccagctttgat
atgccgactgcaattacgaccttccgaggattgcctgctgcacaacgtgagactccttgg
gtcctcgctcagctcggcaaagcgtactatgaagccggaaactttcgaccagcagaagat
tgctttgcaaggctaatgaagatacagccgtcacgcatcgaggacatggacatgtactcc
accgtactctggcacctcaagaaggacaccacactcacgtacctttgtcgcgtgctccaa
gatcatgatagcgatgcgccacagacatgggtcgccgtaggcaatgccttctctttgtct
cgcgaacacgatcaagcaatctcagcgttcaagcgagccactcaagtggatcccaacttt
gcatacgcctacacactgatgggccacgagtacatcgccaatgaagctttcgacaatgct
ctcgcctccttccgacattccgtcagcgttgatcgccgtgggtacggtggctggtatgga
cttgggaaggtgttccagtgcatgggcaaattggacgacgccgagcgccactttcgcatc
gctgcatccatcaacccctccaatgccactttactggtctgcattggcgttgttcttgag
cggcttcgtaacaaaaaaggcgctctggcaaacttcactcgcgcgctggagctggaccct
acatctgccttggcgaggttcaagaaagccagagtgctgatgcatttgaaagagtatgag
caggcgcttggcgagctggaggtgttgcgagatcaggcgcccgatgaggcaaacgtgtgg
ttcctgcttgggaaatgctacaaggggttgagtgagaggggtgaggcgctgagggctttc
acgacggcgttgaatctggatgtgaaggccgcgccgttcatcaaggaggctatggaggct
cttgacgaggaagacgaggagagtgacgat

DBGET integrated database retrieval system