KEGG   Zymoseptoria tritici: MYCGRDRAFT_21049Help
Entry
MYCGRDRAFT_21049  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ztr  Zymoseptoria tritici
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    MYCGRDRAFT_21049
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    MYCGRDRAFT_21049
   04113 Meiosis - yeast
    MYCGRDRAFT_21049
Protein phosphatases and associated proteins [BR:ztr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MYCGRDRAFT_21049
Ubiquitin system [BR:ztr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     MYCGRDRAFT_21049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 770 aa AA seqDB search
ASQMRQLIYYHLDNDMLDNANFIAGRLHALEPRNPENSHLLALTYFRLRRFKAAYDFSQK
YGANGRHLGCAYIFAQACLALGRNMDGVTALEKCRSAWAGKNHWNQHSETSRRHMPDASA
ALTLLAKLWRAHGDSGKAGDLFIEVHKQNPFVWDAFEGLCKIGADLKTENMFRPVMELPG
LTETGNGETQIYVDEDSRQPRVLQAKSGSYVSMDDPFTSTVVEELDSLDHRLLGKSVLGL
PLKPTSTEWDTPTANGGVLDDDTAMGGISAENDDTFFEPPAAPNRRSRMGHHPEVTDRPR
PHGLRNQSASEGLSDDPLAAPRKATAGGQKRNISGTAAQSSLDSTQPRRSNRLFTQTTAP
NRSTRSTMDTAASIAGRADRVARQAKPATGARGRTGAVVGRVVSGNTKRLPPDEKEKRTN
GRTNEKNATLARSEQQDAMASLLNNFRHLAVGCHAIASFDMPTAITTFRGLPAAQRETPW
VLAQLGKAYYEAGNFRPAEDCFARLMKIQPSRIEDMDMYSTVLWHLKKDTTLTYLCRVLQ
DHDSDAPQTWVAVGNAFSLSREHDQAISAFKRATQVDPNFAYAYTLMGHEYIANEAFDNA
LASFRHSVSVDRRGYGGWYGLGKVFQCMGKLDDAERHFRIAASINPSNATLLVCIGVVLE
RLRNKKGALANFTRALELDPTSALARFKKARVLMHLKEYEQALGELEVLRDQAPDEANVW
FLLGKCYKGLSERGEALRAFTTALNLDVKAAPFIKEAMEALDEEDEESDD
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
gcctcgcagatgcgacagctgatctactaccacctcgataacgacatgctcgacaacgcc
aacttcattgctggtcgccttcatgcactcgaaccacgaaatcccgaaaattcgcatctc
ctcgccctcacctactttcgcctccgccgattcaaggccgcctacgatttcagtcaaaag
tacggcgctaatggtcggcatcttggatgtgcgtatatctttgcacaggcgtgcttggca
ttggggaggaacatggatggtgtgacggcgttggagaaatgccgatctgcttgggcaggg
aagaatcattggaatcaacactcggagacatcgaggcgtcacatgcctgatgcatcggca
gcgcttacacttctggcgaagctgtggcgtgctcatggcgattctggtaaggcgggagac
ctgttcatcgaagtacacaagcaaaacccgttcgtgtgggacgcatttgagggactgtgc
aaaatcggggcggatttgaagacggagaacatgttcaggccggtcatggagttacctggg
ctgacggagacgggcaatggtgagacacagatttacgttgatgaagattcacggcaaccg
cgagtgctgcaggcaaaatccgggtcgtatgtctcgatggacgacccattcacttctacg
gtggttgaggagctggattcgctggaccacaggttgctcgggaagtctgtcctgggacta
cccctgaaaccaacatcgacggaatgggacactcctacagcaaatggcggagtgttggac
gacgatacggcaatgggaggcatttctgccgagaacgatgatacattcttcgagcctccg
gccgcaccaaatcggagatcacgaatgggccatcaccccgaggtcacagaccggccgcga
ccgcatgggcttcggaaccaatctgcatctgaaggactgtcagacgatcctctggcggcg
ccgcgcaaagcgaccgcaggcgggcagaagcggaacatttctggaacggccgcacaatct
tctttggactctacgcaacctcgaagaagcaaccggctcttcactcagacaacagcgccg
aatcgaagcactcgctcaaccatggacacggcagcatcaatagcaggcagggctgataga
gtcgctcgtcaagcaaagccagctaccggcgctcgaggtcggacaggtgctgtcgtcggc
agggtcgtcagtgggaatactaagagacttccacctgatgagaaggagaagcgcacgaac
ggtcgaacaaatgagaaaaacgccaccctcgctagatccgaacagcaggacgccatggcc
tcattgttgaacaacttccgccatcttgccgtcggttgccatgcgattgccagctttgat
atgccgactgcaattacgaccttccgaggattgcctgctgcacaacgtgagactccttgg
gtcctcgctcagctcggcaaagcgtactatgaagccggaaactttcgaccagcagaagat
tgctttgcaaggctaatgaagatacagccgtcacgcatcgaggacatggacatgtactcc
accgtactctggcacctcaagaaggacaccacactcacgtacctttgtcgcgtgctccaa
gatcatgatagcgatgcgccacagacatgggtcgccgtaggcaatgccttctctttgtct
cgcgaacacgatcaagcaatctcagcgttcaagcgagccactcaagtggatcccaacttt
gcatacgcctacacactgatgggccacgagtacatcgccaatgaagctttcgacaatgct
ctcgcctccttccgacattccgtcagcgttgatcgccgtgggtacggtggctggtatgga
cttgggaaggtgttccagtgcatgggcaaattggacgacgccgagcgccactttcgcatc
gctgcatccatcaacccctccaatgccactttactggtctgcattggcgttgttcttgag
cggcttcgtaacaaaaaaggcgctctggcaaacttcactcgcgcgctggagctggaccct
acatctgccttggcgaggttcaagaaagccagagtgctgatgcatttgaaagagtatgag
caggcgcttggcgagctggaggtgttgcgagatcaggcgcccgatgaggcaaacgtgtgg
ttcctgcttgggaaatgctacaaggggttgagtgagaggggtgaggcgctgagggctttc
acgacggcgttgaatctggatgtgaaggccgcgccgttcatcaaggaggctatggaggct
cttgacgaggaagacgaggagagtgacgat

DBGET integrated database retrieval system