KEGG   Zymoseptoria tritici: MYCGRDRAFT_22011Help
Entry
MYCGRDRAFT_22011  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MYCGRDRAFT_22011
Peptidases [BR:ztr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCGRDRAFT_22011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 506 aa AA seqDB search
LVYGTLILYGLHLLLDYFEVAILSPQELLFNAVVYCIPTPLLLDSARRNELRENNMLSQT
HAAKSDAFRRAMGLGGHALLQKGESIGMGGVMRRASMIAGARPVVVTSDAPAGLGNWDNS
CYQNSVLQALASLVSLRSWLSVSEPPGAGPETSTNTALQTTIAKLRDPANNGNHIWTPAQ
LKNMSSWQQQDAQEYFSKIVDELEKEATRAAALKKQPGLETLVDAQHEGGNDQDVLRNPL
EGMTAQRITCTRCGFSEGFSMIPFNCLTVPLGSSFDQDLEDCLDEYTKSEDIEGVECNSC
TLIQAESQLKQMLLTSKSGDATSPPQSIAMPPELRAQIEARLLAIQHALEMDDFSDKTLK
QDCQISPKAYASTTKEREAVLARAPESLAIHINRSIFDELTGAQRKNHAHVRYPAILDLE
PWMASFCSTPTRYALQAVVTHYGRHENGHYICYKKHPRRLDDEVELDEDVPQKESWWRLS
DEDVSLAPEEDVLGQGGVFMLFYERI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttggtctacggaacacttatactctacggactgcatctacttctagactacttcgaagta
gccattctatctccacaggaacttctcttcaatgctgtcgtatactgcatccctacgccg
ttgctattggattccgcccgaaggaacgaactaagggagaacaacatgctgtcgcagaca
cacgcggcgaagagcgatgctttccgcagagccatgggactgggaggacatgcgttgctg
caaaagggggagtctatcggcatgggaggtgtcatgcgacgagcgagcatgatagctgga
gctcgccccgtggtagtcacttcggacgcaccggcgggtctcggcaactgggacaattca
tgctatcagaatagcgttctgcaagcgttggcatctttggtgtccttgagatcctggctg
agtgtgtccgagcctcccggtgcagggccagaaacaagcaccaatactgctcttcagaca
acgattgcaaaactcagagatcctgcaaataatgggaaccatatctggacgccggcacaa
ttgaagaacatgagcagttggcagcagcaggacgcacaggagtacttttcgaagattgtc
gatgaattggagaaggaagccacaagagcggctgctttgaagaaacagcctggtttggaa
actttggtggatgcacagcatgagggcggaaacgatcaggacgttttgaggaatccgctc
gaaggcatgactgctcaacgaatcacctgcacacgatgtggcttttccgagggattctca
atgatcccgttcaattgcctcacggttcccctcggctcttccttcgaccaggatcttgag
gattgcttggacgagtacacaaagagtgaggacatcgaaggcgttgagtgcaacagttgc
actctcattcaagcggagagccaactgaagcagatgcttttaaccagcaaaagtggagat
gctacatctccaccgcagagcatcgcaatgcctccagaattgcgtgcacagatcgaagcc
cggctacttgctattcagcacgccttggagatggacgacttctcggacaagaccttgaag
caagattgccaaatatcaccaaaggcctacgccagcaccaccaaggaacgagaggctgtt
ctggctcgagcgcctgagtcactcgctattcacatcaacaggagtatattcgacgagttg
acgggagcccagaggaagaatcatgcacatgttcgttacccagcaattctggacctcgag
ccctggatggcgagtttctgcagcacgccgacgcgatacgctctgcaagcagttgtgacg
cactacggaagacacgagaatggccactacatctgctacaagaagcaccctcgccggcta
gacgatgaggtcgagcttgatgaggatgtgccgcagaaggagagctggtggcggctgagc
gatgaggacgtgtcgcttgcgcctgaggaggacgttctgggtcaaggcggcgtgttcatg
ctcttctacgagcgcatt

DBGET integrated database retrieval system