KEGG   Zymoseptoria tritici: MYCGRDRAFT_23406Help
Entry
MYCGRDRAFT_23406  CDS       T02285                                 

Gene name
MgAMY5
Definition
(RefSeq) alpha--amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_23406 (MgAMY5)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MYCGRDRAFT_23406 (MgAMY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 13400289
NCBI-ProteinID: XP_003855267
JGI: Mycgr3_23406
UniProt: F9X4T7
Position
2
AA seq 555 aa AA seqDB search
PTPANTLLLQSFEWHTPSPHPTTGQSHYVHLTNLLPSLVENLGITHLWLPPGCKANDPSG
RGNGYDCYDLWDLGEFDQKWRRETKWGSKEELMVLLEKARELRVEVIWDAVLGHKTAGDE
IDLGEDGSGVWAVEVEGSDRHHELCPPKKIHPWLKFNFPGRLNPSNSNPASTFQWNATHF
SGVDWCDREKRNAIFKLISDPATHPRPNPSQLPFPIPGRWAEDVDQSNGNNNYLMFSSID
YTHPTVRSDTLSWSRWMITTTGISGFRLDAAQHISRSFLRDFIATSVSTHRDHHAGKDPF
IVAEVWTPEVANQNTFLDGVTPSPDVLVRVFDTPLLNNFARISADVVSSSPNADLRTILL
NPSDPAHASLVSLRPTQAVTFVANHDTQAGQSMETPISPDLKVLFYAFILLRKEGTPCVF
WGDLYGTQGPHGVGPACQVPTGDGGRSTRSLLPTLCLARNLFAYGEQRDYFDESGCIAWT
RAGTWDREGCCVVLSLGGRWTGKRMWVDRGRGERWVDLLSGRRVSVGGDGWRVFEVKGRG
VGVWVREGAEGVGRF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
cctactccagccaacaccctcctcctccaatccttcgaatggcacactccctctcctcac
ccaaccacgggccaatcacactacgtccacctcaccaatctcctcccgtcattggtcgaa
aacctcggaattacacatttatggctcccaccaggctgtaaagccaacgaccccagcgga
cgtgggaatggatacgattgttatgatttatgggatttgggggagtttgatcagaagtgg
aggagggagactaagtgggggagtaaggaggagttgatggtgctgctggagaaggcgaga
gagctgcgggttgaggtgatttgggatgcggttctggggcacaagaccgcgggggatgag
attgatttgggagaggatgggagtggggtttgggctgttgaggttgaggggagtgaccgc
caccacgaactctgcccacccaagaaaatccacccctggctaaaattcaacttccccggc
cgcctcaatccctccaattccaaccctgcttccaccttccaatggaacgccacccacttc
tccggcgtagactggtgcgaccgcgagaagcgcaacgcaatcttcaaactcatctccgat
cccgccactcatccccgaccaaatccttctcaactcccctttcccatccctggccgctgg
gcagaagacgtcgatcaatccaatggcaacaacaactatctcatgttctcttccattgac
tacacccaccccactgtccgctccgacaccctatcctggtcccgctggatgatcaccaca
accggcatctccgggttccggctcgacgcagcacagcacatatcccgctccttcctacgg
gacttcatcgccacgtccgtctccactcaccgagatcaccacgccggaaaagatcccttc
atcgtcgccgaagtctggacgcctgaagtcgccaaccaaaacacattcctcgacggcgtc
actcccagtccagacgtcctcgtccgcgtattcgataccccactgctcaacaactttgcc
cgcatatccgcagacgtagtctcctcctcccccaacgcagacctccgaaccatcctactc
aacccctccgaccctgcccacgcctcactcgtctccctccgcccgacgcaagcggtcacc
ttcgtcgcgaaccacgatacccaagccggacaatcgatggagacaccgatctcccccgac
ctgaaagtcttattctacgcattcatcctcctccgcaaagagggcacaccctgcgtcttc
tggggcgatctctacggtacacaaggaccgcatggcgtcggaccagcttgccaagtccct
accggagacggaggaagaagcacgagatccctcctccccaccctctgtctcgcgaggaac
ttattcgcctacggcgagcagagagactacttcgacgagagcggatgtattgcctggacg
agagcggggacgtgggatcgggagggttgttgtgtggtgctgagtctaggagggaggtgg
acggggaagagaatgtgggttgacaggggaaggggagaaaggtgggttgatttgttgagt
ggaaggagggtgagcgttgggggggacgggtggagggtttttgaagtaaagggacgaggg
gtgggggtttgggttagagagggggcggagggagttgggaggttt

DBGET integrated database retrieval system