KEGG   Zymoseptoria tritici: MYCGRDRAFT_23780Help
Entry
MYCGRDRAFT_23780  CDS       T02285                                 

Gene name
DOT2401
Definition
nucleosomal histone H3-Lys79 methylase
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ztr  Zymoseptoria tritici
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MYCGRDRAFT_23780 (DOT2401)
Enzymes [BR:ztr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MYCGRDRAFT_23780 (DOT2401)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 401 aa AA seqDB search
SNDTEGSESDASRKRLKSSPSSVDSRPPRASLLSKEAFAEEAVIDIIHGADVTSGEHKDK
FKNPWEDEDFQTVSLQYPSRSQQERFELKFPIQAEDYKPMEDITETIKTICTYYFPAELA
TKYSHDEAGYARRFNRAWQRQSVEDFIEVINDFNTTLQDLLSDGSIQTRLSGHRNIDLEW
IQRIIDQIYARTVSWKVETLRRYENFSNNVYGELLPRFCSEIFQKTGLNHKQIFVDLGSG
VGNVVLQAALEIGCESWGIEMMDNPCELAALQAREFPARTRLWGLSVGEVHLLKGDFTKN
EEILEVLKRADVVLVNNQAFDPALNDTLRDMFLDLKDGCRVASLKPFVPVGHKMAMRNID
SVVNQFTQQKFEYWSDSVSWGADHGEYFVATKDPRPARAFM
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
agcaacgacactgaagggagcgaatcggacgcctcgcgcaaacggttgaagagcagtccg
agctcggtggacagcagaccccctcgggcatctttgttgtcgaaagaggcgtttgccgag
gaggctgttatcgacattatccatggcgcagatgtaacgtcaggagaacacaaggacaag
ttcaagaatccctgggaagacgaagacttccaaactgtttctcttcagtatccgagccgg
agtcaacaggaacggttcgagctgaagttcccaattcaagcagaagattacaagcccatg
gaggacatcaccgagacaatcaagaccatctgcacatattacttcccagcagagctcgcc
acgaagtacagtcacgatgaggccggctacgcacgacgcttcaatcgggcctggcagcgt
caaagcgtcgaggactttatcgaagtcatcaacgacttcaacactacccttcaggacctt
ctctccgatggctccattcaaacacgactcagcggacaccgcaacatcgatctcgagtgg
atccagcgtatcatcgatcaaatctacgcccgcactgtcagttggaaagtcgagacttta
cggcggtacgagaatttcagcaacaacgtctacggcgaactcctcccgcgcttttgtagc
gagatttttcagaagacaggcctcaaccacaagcagatcttcgtcgacctcggctccggc
gtgggcaacgttgtgcttcaagcggcgctcgagattggatgcgagtcctggggcatcgag
atgatggacaatccttgcgaactggccgctttgcaagcgagagagttccccgctcggact
cgtctctggggtctctcggtcggagaagtgcacctcctcaaaggcgactttactaagaac
gaggagattctcgaggtcctcaagcgcgcggacgtggtgctggtcaacaatcaagcgttc
gacccggcgctcaacgacacattgcgggacatgttccttgatctcaaagatggctgtcga
gtagccagtctgaaaccattcgtgcctgtgggacacaagatggcgatgcgaaatattgac
tcggtggtcaatcagttcacgcagcaaaagtttgagtactggtcggactcagtcagctgg
ggtgcggaccatggggagtacttcgtggcgacgaaggatccgagaccagccagggcgttt
atg

DBGET integrated database retrieval system