KEGG   Zymoseptoria tritici: MYCGRDRAFT_29871Help
Entry
MYCGRDRAFT_29871  CDS       T02285                                 

Gene name
POM1
Definition
serine/threonine protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MYCGRDRAFT_29871 (POM1)
Protein kinases [BR:ztr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   MYCGRDRAFT_29871 (POM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 419 aa AA seqDB search
DKDDLSADDEMRRLSQKRRDVDTAAKESEELKRRAVARSPMSPDRVLHDRNCTLNIFERG
EIVDYAKEGVFFTGTKSARKIIGSLTPSPTSGGDKEKAGNYGYDDERGDYNIVMGDHLAY
RYEVVDLLGKGSFGQVVRCVDHKDGGIVAIKIIRNKKRFHQQALVEVGILSRLREWDPDG
ANATLSITSSFYFRSHLCIVTPCLSINLYELIRAHNFGGFSLPLIRRFSRQLLSCLVLLQ
NKRIIHCDLKPENILLCEARKADVRVIDFGSSCKEEEKVYTYIQSRFYRSPEVILGSSYG
LGIDMWSLGCILAELWTGYPLFPGENEQEQLACIMEIFGPPDRHLVERSTRKKLFFDSVG
KPRVTVSSKGRRRRPSSKTLSQAMKTDDEAFLDFISRCLRWDPERRMKPHEAIHHPFIT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gacaaggacgacctctcagccgatgacgaaatgcggcggctgtctcaaaagcggcgcgat
gttgacacggcagctaaggaaagcgaagagttgaagcgacgagctgtcgcgcgctcgccg
atgagccctgatcgggtactccacgaccgcaattgcaccttgaacatctttgagcgtggc
gagattgtcgattatgccaaggaaggggtgttctttactggtacaaagagtgctcggaag
atcattggaagcctcacgccatcgccaacttctggcggcgataaggagaaggctggcaac
tacggctacgacgatgaaagaggcgactacaatattgtcatgggcgaccacctcgcttat
cgatacgaagtggtcgaccttctcggcaaaggcagctttggacaggttgtgagatgcgtt
gatcacaaagacggaggcattgtggctatcaagatcatcaggaacaagaagcgctttcat
cagcaagcattggtcgaagtgggcatcttgagccgtctaagggaatgggatcccgacggc
gccaatgccaccctctcgatcacttcttctttctacttccgctcgcatctttgcatcgtc
acaccctgtctcagcatcaacctttacgagctcatccgagcgcacaactttggcggcttc
tcgttgccactcattcgccgcttctctcgccaactgctgtcctgcctggtcctcctgcag
aacaagcgcatcattcactgcgatcttaagcctgagaacatactgctttgcgaagctcgc
aaggccgatgtccgggtcattgactttggcagcagttgcaaggaggaggaaaaggtctac
acctacatccagtctcgattctatcgcagtccggaagtcatactcggcagcagctacgga
ttggggatcgatatgtggtcactgggatgcatcctggccgagctgtggaccggttatccg
ctgttccccggagaaaacgagcaggagcagcttgcctgcataatggagatattcggccca
ccagaccgacatctcgtggagcgatcaacgaggaagaagctgttcttcgattcggttggc
aaaccccgcgtgactgtcagcagtaagggacgacggcgaaggccaagttcgaagaccttg
tctcaagcaatgaagactgatgacgaagccttcctggacttcatctctcgctgccttcga
tgggaccccgagcgcaggatgaagccccacgaggccattcatcatcccttcatcaca

DBGET integrated database retrieval system