KEGG   Zymoseptoria tritici: MYCGRDRAFT_31949Help
Entry
MYCGRDRAFT_31949  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00330  Arginine and proline metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYCGRDRAFT_31949
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MYCGRDRAFT_31949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 13399123
NCBI-ProteinID: XP_003857184
JGI: Mycgr3_31949
UniProt: F9X1A0
Position
1
AA seq 385 aa AA seqDB search
MTRISLPFLTLLGLASARDIVFPPVAAMQQPIGSFAVDIAEDPALDISGARYLGLTTYAN
LPYVHCLAAEGEEVEAYDIAFLGAPFDTGVTARPGARFGPNGIRQGSRRIEEEAAWNVYT
GMNPFKQGLVIRDCGDAPLTVLDNTIALKQLDKAHKVVSGRKTNSSEFTVPRIITLGGDH
TTTLSALRSTFNHFGKVSVIHFDSHIDTWDPQVLSGGISDYAGVNHGTFLHIAAEEGLIS
NSSIHAGIRAPVANKKYDMKHDRACGFHNLKARDLDKLGMAGFIEKIKERVAGSKVYISV
DIDVLDPAYAPATGTAEPGGWTTRELLTILDGLNGLEVVGADVVEVAPVYDNGGETTVLA
AAEVALALLQVMVDTEVAPVEKPSA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcataagtctacccttcttgacccttctcggcttggccagtgctcgagacatc
gtcttcccgccagtagcagctatgcagcagcccattggtagcttcgcagtagacatcgca
gaagacccagcactcgatatctcaggagcacgatatctgggcttgacgacttacgccaac
ttgccatatgtccattgcctcgcagcagagggcgaggaggtcgaggcctacgacattgct
tttctgggagcgccgttcgatacaggtgtgacggctcggcctggagctcgatttggaccg
aatggcattcgtcagggttcgagacggatcgaagaagaagcggcttggaatgtttataca
ggtatgaatccgttcaaacagggccttgtaatcagggattgcggtgatgcgccattgacg
gtacttgataatacgatcgccctcaagcagctcgacaaagctcacaaggtcgtctccggc
cgcaagaccaactcatctgagttcacagttcctcggatcatcaccttgggaggcgaccac
accacaacactatcagcccttcgatcaacgttcaatcacttcgggaaggtcagcgtgatt
cacttcgacagccacatcgatacatgggatcctcaagtactgtcgggaggcatctcggat
tacgctggggtcaatcacggcacgtttcttcacatcgcagcggaagaaggactgatcagc
aattcgtccattcatgccggaatcagagcgccagttgccaacaagaagtatgacatgaag
catgatagagcgtgtggtttccacaacctgaaggcgagagatctcgacaagctgggcatg
gcgggtttcatcgagaagatcaaggagagagtcgctgggtcgaaagtgtatatttcggtg
gatatagatgtccttgatccggcatacgcaccggctacaggaactgccgagccaggtgga
tggacgacgcgagaactgctcacgattctcgatggtttgaacggcctggaagttgtcgga
gccgatgtcgtcgaggtggctcccgtgtacgacaatggtggagagaccacagtactcgca
gcggcagaggtggccctcgctctgctgcaggtcatggtcgatactgaggtggcaccggtg
gaaaagccttctgcatga

DBGET integrated database retrieval system