KEGG   Zymoseptoria tritici: MYCGRDRAFT_33113Help
Entry
MYCGRDRAFT_33113  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ztr  Zymoseptoria tritici
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ztr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 406 aa AA seqDB search
MALRLLTSVLALSTLTTAHGDHSHDHHEAEDPQQPFIGWTKEDLDAKWGTDWGFSGISTF
AHLPHIRCLQHPSQTYDIAILGAPFDTAVSYRPGARFGPRAIRAASARQTAMRGYNPRAN
LNPYTSWATVLDCGDIPITPFDNSLAIHQMSLAFSQLSNSPVPQSSFSSNIPYRHFPKLI
TLGGDHSIALPTLRALQAVHGPIAVVHFDAHLDTWHPAKYPTAWLNPDDSTFQQSFMTHG
TMFWLAHNESLLLPHKSVHAGLRTRLSGAEDDEDDDAQGWSRIACDDIDDLGARGVAEKI
MKHVGTEVPVYLSIDIDVIDPGLAPGTGTPEPGGWTTRELIRVLRGIEGLNVVGADVVEV
SPAFDGAGEVTALAAAQVVFEVLTSVVKRGLSDGGEERRGKGRDEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagactactgaccagcgttctggccctctcaactctaacaacagcccacgga
gaccactcccacgaccaccatgaagccgaggatcctcaacaaccattcatcggctggaca
aaggaagacctcgacgccaaatggggcaccgactggggtttcagcggcatctcgacattc
gcccacctcccccacatccgctgcctccagcacccctcccaaacctacgacatcgccatc
ctcggcgcccccttcgacaccgcagtctcctaccgcccgggagcccgcttcggcccccgc
gccattcgcgccgcctcagctcgccaaaccgcaatgcgaggctacaaccctcgcgcgaac
ttgaacccctacacctcctgggcgaccgtgctcgactgcggcgacatccccatcacaccc
ttcgacaacagcctcgccatccaccaaatgtccctcgctttctcccaactctccaactcc
cctgtcccacagtcctccttctcctccaacatcccctaccgtcatttccctaaactcatc
accctgggcggggaccactccatcgccctccccaccttgcgagccctacaagccgtccac
ggaccgattgctgtcgtccacttcgacgcgcatctagatacctggcatccggcgaaatac
cccaccgcctggctcaacccggacgactccacgttccagcaatcattcatgacccacgga
acgatgttctggctcgctcataacgagtccctgctcttaccccacaagtccgtccacgct
ggtctccgaacccggctttccggcgcggaagacgacgaagacgacgatgcgcaaggctgg
tcgcgcattgcgtgtgatgatattgatgatcttggcgcacgaggcgtagcggagaagatt
atgaagcacgttggtacggaggtcccggtatatctgagtattgacatcgatgtcattgat
cccggattggcacctggaacgggaaccccagaaccgggcggttggacgacgagagagtta
ataagggtgttgagggggattgaagggttgaatgtcgtgggggcggatgtggtggaggtg
agtccggcttttgatggggctggggaggtgacggcgttggcggcggcgcaggttgttttt
gaggttttgacgagtgttgttaagagggggttgagtgatggtggtgaggagaggaggggg
aaggggagggatgagttgtag

DBGET integrated database retrieval system