KEGG   Zymoseptoria tritici: MYCGRDRAFT_34505Help
Entry
MYCGRDRAFT_34505  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ztr  Zymoseptoria tritici
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MYCGRDRAFT_34505
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MYCGRDRAFT_34505
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MYCGRDRAFT_34505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 383 aa AA seqDB search
QIGEVARIVHYLRKHLVNRTIASCQGFDDDIVYGKVGCTATAFSQAFTGKRVSLAGQQGK
YFYLTLAESKVHSVLHLGMTGWIKFNIEETGYYRQGKDKPVTEEWPPKYVKWLMKIDAEG
EREALEVAFVDPRRLARIRLVECEAGEIRRVSPLKENGPDPVIDKDIVTLEWMTALMRRK
KVPVKGLLLDQANISGVGNWVADEVLYQARLHPEQYSNTFSDEEIGRLRDALLEVTGIAC
ATLSDSEQFPSDWLMKHRWDKGKKASNVLPNGEKIVHLTVSGRTSAIVPSVQKKTGNVAG
DFKEDDVEDGAEEKKEKKKPPVEDEVEEAEEGEHEPEPKKVTKAKKSKATPKKSESTPKA
KAAPKKAEKQATPGERKSTRTRR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
cagatcggcgaagtcgcccgcatagtccactacctccgcaaacacctcgtcaaccgcacc
atcgcttcctgccagggcttcgacgacgacatcgtctacggcaaagtcggctgcaccgcc
accgccttctcccaagccttcaccggcaagcgagtctccctcgccggccagcaaggaaaa
tacttctacctcacgctcgccgagtccaaagtccactcggttctacacttgggaatgacg
ggatggatcaagtttaatattgaggaaacgggatactatcgccagggaaaggataaacct
gtgacggaagagtggccgccgaaatatgtcaagtggttgatgaagattgatgccgagggg
gagagggaagcgttggaggtcgcgtttgtggatccgagacggttggcgaggattcggttg
gtggagtgtgaggcgggggagatcagaagggtgtcgccgttgaaggagaatgggccggat
ccggttattgataaggatattgtcactttggaatggatgactgcgttgatgagaaggaag
aaggtgcctgtgaagggactactgcttgatcaagcgaatatctccggggtggggaattgg
gtcgccgacgaggtactgtaccaagcacgcctccaccccgaacaatacagcaacaccttc
tccgacgaggagattggacgactaagagacgcgctcttggaagtcacaggcatcgcctgc
gcgacactttccgatagcgaacaattcccctcggactggttgatgaagcatcgctgggat
aaagggaagaaggcgagtaatgtgctgccgaatggggagaagattgtgcatttgacggtt
agtgggaggacgagtgcgattgtcccgagtgtgcagaagaagacggggaatgtggcgggg
gatttcaaggaggatgatgtggaggatggtgctgaagagaagaaggagaagaagaagccg
cctgttgaggacgaggtcgaggaggcggaagagggggaacatgagcctgagccgaagaag
gtgaccaaggcgaagaagtccaaagccacaccgaaaaagtccgagtccacgcccaaggca
aaagcagcaccgaagaaggcagaaaagcaagctacgcctggtgagaggaagtccactcga
acacggagatga

DBGET integrated database retrieval system