KEGG   Zymoseptoria tritici: MYCGRDRAFT_35514Help
Entry
MYCGRDRAFT_35514  CDS       T02285                                 

Definition
SNF2 family DNA-dependent ATPase domain-containing protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ztr  Zymoseptoria tritici
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MYCGRDRAFT_35514
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     MYCGRDRAFT_35514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 979 aa AA seqDB search
MKPFKPPSFKAPAFVGSKPRELAASEPREPASEPPAKRRRISERDDVDGRDLSFDVTRSA
TNGTLLVKTALPPSSGAAKKFVAPAPRKPLDPVRNPSSSGGSEAEKVTQSYYNVLWRKFT
TKKNKTWDGDGVLSVKGTYATLQDISGKELGRGVCKGPLLIGSELSIGGKEIEVDTMISR
EDYLAGRPFLGSKKVEKAPLLKDIDGTKKVTNKAQARQEKIAAHQKDPTTKVQALSKTSN
NAFKTPVINSNVQHQERNAKEAVPRHKVDGENALVMKRPKSVPKGRQMVDVVVDPILTRA
LREHQRVGVSFLYECVMGMKDFDGEGAILADEMGLGKTLQTIALLWTLLKQDPAQNPAQP
GIGLIKKALIVCPVTVIKNWKKEIYKWLGKTGISVFVADNHNRITDFTKGKCYNIMIIGY
EKLVKVQKQLQEAKIDIVIADEGHRLKTAANKAAQAIKSLNTDKRIILSGTPIQNDLSEF
FMMVDLVNPSVLGKYTTFKREFEGPIVASRQPGATAAALEKGEARSEELANITNMFILRR
TSEILSKYLPPKTEYVVFCKPTKVQKQIYRAVIEAPVFVAAMNTPTEVLRLITMLKKVCN
APKLLIKKDEKGNEERVADLIEHIPQSLLKAPHASGKLAVLDDLLFQIDTKTDEKVVLVS
NYTSTLDVLQDFIGLLGYSWLRLDGSTPVAKRQDLVDTFNRSPKTKSFVFLLSAKAGGVG
INLIGASRLILYDLDWNPATDLQAMARVHRDGQKRPCHIYRLLTQGALDEKIFQRQISKT
GLAESIVDGKSAASGFSQAELRDLFKLDESDDCQTHKLLGCSCGGNGLPVVGDDTETSSE
RNDLASLSDRPEIEVVHLEDSDEVPAATTRRWQTLGSVDVDAREAEIERKGKESRDSAGN
AKMLSLMRYTHFDTALIGGGAGKVDEEEGDISELDVVDVAIEDKALQEVLKKEGRRVGFV
LVKRGHENDVAEDKEVEVV
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccttcaagccgccgtcgttcaaagcgccagccttcgttggcagcaaacctcga
gaactagcagccagcgaaccccgagaaccagccagcgagcctccagcaaagcgacgtcga
atcagcgaaagagatgatgtcgacggaagggatctcagcttcgacgtgacacggtcagcc
accaacgggactctgcttgtgaagacagcactcccgccatccagtggagcggccaagaaa
tttgttgcaccggctccaaggaagcctctcgaccctgtgcgaaaccccagcagctctgga
gggagtgaggccgagaaagtcactcaaagctactacaacgtcctctggcgaaagtttacc
accaagaagaataagacatgggatggcgatggagtactctcggtgaagggcacttatgca
acgcttcaggacatttccggaaaggagcttggtcgtggcgtgtgcaaaggaccacttctc
atcggatctgaactgtcaatcggcggcaaagaaatcgaggtcgacacgatgatctcacgg
gaagactacctcgctggaaggccgttcctcggcagtaagaaggttgagaaggcgcctttg
ctcaaggatattgacgggacgaagaaagtcaccaacaaagctcaagcccggcaggagaag
atcgctgcacatcagaaggatcctacaacaaaagtgcaagctttgagcaagacttcaaac
aacgcattcaagacgccagtcataaacagcaatgtgcaacaccaggagcggaatgcaaag
gaagctgtcccacgacacaaggtggatggtgagaatgcactggtgatgaagcggccgaag
agtgtgccgaaaggcaggcagatggttgacgtagtggtcgacccaatcctcactagagcg
ttgcgagagcatcagcgagtgggagtctccttcctgtacgagtgcgtcatgggcatgaaa
gactttgatggtgaaggtgcaattctggccgatgagatggggttgggcaagacattacag
accatcgcacttctgtggactctgctcaaacaggatccagctcagaatcccgcccagcca
ggaattggtctcatcaagaaagctctcatcgtctgcccagtcactgtgatcaagaactgg
aagaaggaaatctacaagtggctgggcaaaactggtatctccgtcttcgtcgcagacaat
cacaatcggatcaccgacttcaccaaaggaaagtgctacaacatcatgatcattgggtac
gaaaagctcgtcaaggtccaaaagcagctccaagaagccaagattgatattgtcatcgcg
gacgaaggtcatcgtctgaagacggcggccaacaaggctgctcaagcgatcaaatcgctc
aacactgacaagcggatcattctcagtggcacgccaattcagaatgacctctcagagttc
ttcatgatggtcgaccttgtcaatcctagtgtcttgggcaagtacacaaccttcaagcga
gaatttgagggtccgatcgtggcttccagacaacccggtgcaaccgcagcggctctggag
aagggagaggctcgcagtgaggagctggccaacatcacaaacatgttcattttgcggcga
acctctgagatcctgtcgaagtatctgcctcccaagacggagtatgttgtgttctgcaag
cccaccaaggtccaaaagcagatctacagagcggtgatcgaggctcctgtcttcgtggct
gcgatgaacacaccgacggaggtcttgaggctgattaccatgctgaagaaagtctgcaat
gctccgaaattgctcatcaagaaggacgagaaagggaatgaagagagggttgctgacctg
atcgagcacatccctcaatctctcctgaaagcacctcatgcgagtggaaaactggccgtc
ctggacgacctcctattccagatcgacaccaagaccgatgaaaaggtcgtccttgtcagc
aactacacttcgaccctcgacgtgctccaagacttcatcggacttctcggctacagctgg
ctccgcctcgacggctcaacaccagtcgccaagcgtcaagatctggtcgacaccttcaac
cgttcgcccaagaccaagtcctttgtcttcctcctctcagccaaagctggcggcgtcggc
atcaacctcatcggggcgtctcgactcatcctctacgacttggactggaatcctgcgacc
gatctgcaagccatggcccgcgtgcatcgagatggacaaaagcgaccctgccacatctac
cgcttactgacgcaaggtgctctcgacgagaagatcttccagcgtcagatcagcaagacc
gggctggcggagagtatcgtagacggcaagtccgccgccagcggcttcagtcaagcagaa
ctccgcgacctcttcaagctggacgagagcgatgattgccagactcacaagttgctgggt
tgcagctgtggcggcaatggccttcccgttgttggagatgataccgagacctcatcggag
cgcaacgacctcgcttctctaagcgacagacccgagatcgaggtcgtacatctcgaagac
agcgacgaagttcctgccgctacgacgagacgctggcaaacccttggcagcgtggacgtc
gatgcaagagaggctgagatcgagcggaaaggaaaagagagtcgcgactcggctggtaat
gcgaagatgctgagtctgatgcggtacacgcatttcgatacggcgttgatcggcggagga
gccggcaaggttgatgaggaagagggcgacatctcggagctggacgtcgtggacgttgcc
atcgaagacaaggcgctgcaggaggtgttgaaaaaggaagggaggagagtgggattcgtg
ctggtcaagagagggcatgagaatgatgttgccgaagacaaggaggtggaggttgtttga

DBGET integrated database retrieval system