KEGG   Zymoseptoria tritici: MYCGRDRAFT_35698Help
Entry
MYCGRDRAFT_35698  CDS       T02285                                 

Gene name
GliG
Definition
(RefSeq) putative glutathione S-transferase
Organism
ztr  Zymoseptoria tritici
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 248 aa AA seqDB search
MGIEISPWSLIRVVQTAWKCIPASDICTANDITADQTSYINYIKPIILAEELKVDYTMSI
IDTKTEWAYRIHPERMVPALRDYDLATGQVARVFESTACLYYLAEKFDTDGTWTGRGPAE
RAQVHSWMALQTAGLGPTAKFWLYFLRGYPTRESPVQLPRTIDKFREATMKQWDLLDARL
SQPEHLYIALPGRPTLADVAFLPFAMPAIFEIFGVDISRWPKIAAWSTRMMERPAVKKVL
DMAPNIGQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgaaatctcgccatggtccttgatcagggtcgttcaaacagcatggaaatgc
atacccgcctcggacatatgtacggctaacgacattacagcggatcaaacatcctacatc
aactacatcaagcccatcatcctggcagaagagctcaaggtcgactataccatgtccatc
atcgataccaagaccgagtgggcgtatcgcattcacccggagcgaatggtcccagctctt
cgcgactacgatctcgcgaccgggcaagttgctcgtgtgttcgaatccacggcatgtctt
tactatctcgccgaaaaatttgacacggatgggacgtggacagggcgtgggcccgcggag
cgcgcccaggtacattcttggatggcgttgcagactgctggccttggtcctacggcaaaa
ttctggctgtatttcctgcgcggttatcctacacgtgagagtcctgtgcagctgccacgg
accatagacaagtttcgcgaagccaccatgaagcaatgggatctactggacgctcgtctc
tcgcagcccgagcacctctacattgcgctgcccggccggccgacactggctgatgtcgca
tttcttccctttgcaatgcccgcgatcttcgaaattttcggcgtcgacatcagccgctgg
ccgaaaattgctgcgtggtcgactcgcatgatggagcgaccggctgtgaaaaaggtgctg
gacatggctcccaacattggacagtag

DBGET integrated database retrieval system