KEGG   Zymoseptoria tritici: MYCGRDRAFT_35698Help
Entry
MYCGRDRAFT_35698  CDS       T02285                                 

Gene name
GliG
Definition
putative glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ztr  Zymoseptoria tritici
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ztr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 248 aa AA seqDB search
MGIEISPWSLIRVVQTAWKCIPASDICTANDITADQTSYINYIKPIILAEELKVDYTMSI
IDTKTEWAYRIHPERMVPALRDYDLATGQVARVFESTACLYYLAEKFDTDGTWTGRGPAE
RAQVHSWMALQTAGLGPTAKFWLYFLRGYPTRESPVQLPRTIDKFREATMKQWDLLDARL
SQPEHLYIALPGRPTLADVAFLPFAMPAIFEIFGVDISRWPKIAAWSTRMMERPAVKKVL
DMAPNIGQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgaaatctcgccatggtccttgatcagggtcgttcaaacagcatggaaatgc
atacccgcctcggacatatgtacggctaacgacattacagcggatcaaacatcctacatc
aactacatcaagcccatcatcctggcagaagagctcaaggtcgactataccatgtccatc
atcgataccaagaccgagtgggcgtatcgcattcacccggagcgaatggtcccagctctt
cgcgactacgatctcgcgaccgggcaagttgctcgtgtgttcgaatccacggcatgtctt
tactatctcgccgaaaaatttgacacggatgggacgtggacagggcgtgggcccgcggag
cgcgcccaggtacattcttggatggcgttgcagactgctggccttggtcctacggcaaaa
ttctggctgtatttcctgcgcggttatcctacacgtgagagtcctgtgcagctgccacgg
accatagacaagtttcgcgaagccaccatgaagcaatgggatctactggacgctcgtctc
tcgcagcccgagcacctctacattgcgctgcccggccggccgacactggctgatgtcgca
tttcttccctttgcaatgcccgcgatcttcgaaattttcggcgtcgacatcagccgctgg
ccgaaaattgctgcgtggtcgactcgcatgatggagcgaccggctgtgaaaaaggtgctg
gacatggctcccaacattggacagtag

DBGET integrated database retrieval system