KEGG   Zymoseptoria tritici: MYCGRDRAFT_35698Help
Entry
MYCGRDRAFT_35698  CDS       T02285                                 

Gene name
GliG
Definition
(RefSeq) putative glutathione S-transferase
  KO
K22119  
gliotoxin biosynthesis glutathione S-transferase [EC:2.5.1.-]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     MYCGRDRAFT_35698 (GliG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2
AA seq 248 aa AA seqDB search
MGIEISPWSLIRVVQTAWKCIPASDICTANDITADQTSYINYIKPIILAEELKVDYTMSI
IDTKTEWAYRIHPERMVPALRDYDLATGQVARVFESTACLYYLAEKFDTDGTWTGRGPAE
RAQVHSWMALQTAGLGPTAKFWLYFLRGYPTRESPVQLPRTIDKFREATMKQWDLLDARL
SQPEHLYIALPGRPTLADVAFLPFAMPAIFEIFGVDISRWPKIAAWSTRMMERPAVKKVL
DMAPNIGQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgaaatctcgccatggtccttgatcagggtcgttcaaacagcatggaaatgc
atacccgcctcggacatatgtacggctaacgacattacagcggatcaaacatcctacatc
aactacatcaagcccatcatcctggcagaagagctcaaggtcgactataccatgtccatc
atcgataccaagaccgagtgggcgtatcgcattcacccggagcgaatggtcccagctctt
cgcgactacgatctcgcgaccgggcaagttgctcgtgtgttcgaatccacggcatgtctt
tactatctcgccgaaaaatttgacacggatgggacgtggacagggcgtgggcccgcggag
cgcgcccaggtacattcttggatggcgttgcagactgctggccttggtcctacggcaaaa
ttctggctgtatttcctgcgcggttatcctacacgtgagagtcctgtgcagctgccacgg
accatagacaagtttcgcgaagccaccatgaagcaatgggatctactggacgctcgtctc
tcgcagcccgagcacctctacattgcgctgcccggccggccgacactggctgatgtcgca
tttcttccctttgcaatgcccgcgatcttcgaaattttcggcgtcgacatcagccgctgg
ccgaaaattgctgcgtggtcgactcgcatgatggagcgaccggctgtgaaaaaggtgctg
gacatggctcccaacattggacagtag

DBGET integrated database retrieval system