KEGG   Zymoseptoria tritici: MYCGRDRAFT_37582Help
Entry
MYCGRDRAFT_37582  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MYCGRDRAFT_37582
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     MYCGRDRAFT_37582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 664 aa AA seqDB search
ESLVDQVSSWIKEKRAKRSHRKASRKAEDDSAPASPTSMVPVNGKESRPRRGSHASDTSL
DLEKLERIVKQTLHLRRSSARKIPHFRRKSSARKLLRKPSSASDTEYFEGDVLVPTCDVV
LDNSKTLSYTGGASDVSDESGEEELKRVGSVRDNDAWSRFKFEIVRLSHTLRLKGWRRVP
LEMCGSVEVQRLSGALTNAVYVVSPPEDLPLQKEDGTTAKPPPKLLLRIYGPQVEHLIDR
QAELAILQRLARKRIGPRMLGTFANGRFEEFFHAETLTPEDLKDASTSRQIAKRMRELHD
GIELLDQERDDGPFVWRNWDKWLQRVEQIVTWMDSQIAAQDPNTKPTGSKAWMRRGYICG
VPWQQFKAVVEKYRAWLKAQYGGSKHLREQLVFAHNDTQYGNILRLVPAGKSPLLLPANS
HKQLVVIDFEYASANTPGLEFANHFTEWCYNYHDKRKPYACNTNTYPTPEEQDRFIRAYV
RHRPQFNAATDTPHMTPVGTPDSARPADLARRSTTSISDFMLDARVPPGSSSTNLAAEAA
TKSAEDAEVKHLMHETRMWRLANTAQWVAWGIVQAKVPGMPLFDPDSPASELSQGEDVAK
EIFGEDGLAMPKEEDGEEQEEEFDYLGYAQHRAMFFWGDAVQLGLIGEEELPEEVRGKVK
TVLY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gaatccctggtggatcaggtgtccagctggatcaaggagaagcgagccaaacgaagccat
cgcaaagcgagtcggaaagccgaagatgatagtgcaccggccagtccgacttcgatggtt
cccgtgaatggaaaagaatctcggccaaggcgcggatcacacgcctcggacacatcactc
gacttggagaaacttgagcgcatcgtgaagcaaactctacatctcaggcgctcttccgca
cggaaaattccacacttcagacgaaagtcatctgcccgcaaactgcttagaaagccgtcc
agcgcatcggatacagaatattttgagggagatgtcctggtgccgacttgcgatgttgtg
ctcgacaactccaagactctttcctacacgggtggtgcatcggatgtctcggatgagtcg
ggtgaggaggaattgaagcgtgttggctcggtccgtgacaatgatgcatggtcgagattc
aagtttgagattgtgcgcctctcacacacgttgcgtctgaaaggttggcggagggtcccg
ttagagatgtgcggctcggtcgaggtccagcgtctcagcggagcgctgacgaatgcagta
tacgtcgtttctccaccggaagatctgccgctgcagaaggaggacggaaccactgccaag
cctccaccaaagttgctgcttcgcatttacggtcctcaagtcgagcacttgatcgatcgt
caggcggagctcgcgattctccaacgcctggccaggaagcgaatcgggccaagaatgctg
ggaacattcgccaatggccgattcgaggagttcttccacgccgagacactcacacctgaa
gatttgaaagatgccagcacgagccgccagatcgccaagcgcatgcgcgagctgcacgat
ggcatcgagctgctggatcaagaacgcgatgacggtccttttgtgtggcgcaactgggac
aagtggttacagcgggtcgagcagatcgtcacctggatggactcacaaattgcggcacaa
gacccgaacacgaagcccaccggttcaaaggcatggatgcgccgtggctacatctgtgga
gtgccctggcagcaattcaaggcggtcgttgagaagtatcgcgcatggctcaaggcgcaa
tacggaggctccaagcacctccgcgagcagctcgtcttcgcccacaacgatactcagtat
ggcaacattctgcgtcttgtacccgctggcaaatcgccactgctcctccctgccaacagc
cacaagcagctcgttgtcatcgactttgagtatgcctctgccaacacacctggtctcgaa
ttcgccaaccacttcacagaatggtgctacaactaccacgacaagcgcaaaccctacgcc
tgcaacacaaacacctacccgacacccgaagaacaagaccgcttcatccgcgcctacgtc
cgtcaccgtccacaattcaacgccgcgaccgacacacctcacatgactcccgtcggcaca
cccgactccgctcgacccgccgacctcgcccgtcgctccaccaccagcatctccgacttc
atgctcgacgctcgcgtcccgcccggctcctcatccaccaacctcgctgccgaagccgct
accaaatccgccgaagacgccgaggtcaaacacctcatgcacgaaacccgcatgtggcgc
ctcgccaacacggcgcaatgggtcgcgtggggaatcgtgcaggccaaagtcccgggcatg
ccgcttttcgacccagactcgcctgcatcggaactgtcgcagggtgaggacgtggcgaag
gagatttttggcgaggatggattggcgatgccgaaggaggaggatggcgaggagcaggag
gaggagtttgattatcttgggtacgcgcagcatcgggctatgttcttttggggagatgcg
gtgcagttggggttgattggggaggaggagttgcctgaggaggttagagggaaggtcaag
acggtgttgtattag

DBGET integrated database retrieval system